0, oldval=, newval= threads=: status= blocked= lockedg=atomicor8 runtime= sigcode= m->curg=(unknown)total < 0traceback} stack=[ gp.goid= lockedm=/godebug/ package  of type omitemptyParseBooldragonflyinvalid nreflect: funcargs(bad indirCallSlice as type Interfacecorostartmorestackpanicwrap buildID=	%-*s	%s
244140625ParseUintinterruptbus errorWednesdaySeptemberlocaltimemap.init.mapassignmapdeletechanrecv1chanrecv2slicecopyclosechanmakemap64makesliceprintlockprintuintprintboolgorecovercmpstringintstringchansend1walkRangeselect %vchanfn %vchanfn %dthrowinitmemequal0memequal8c128equalmemhash16memhash32memhash64interhashuint64divuint64modSliceDatamap valuemap indextypecheckreferencego:embed statement.asanName.hashfunc.eqfunc%dgeneq %v
noverflownevacuateValueSizedirOffsetGroupSize.embeddedPtrToThis %d:%d:%s%s %q: %sempty urlgoroutinePCALAU12IPCADDU12IAMSWAPDBBAMSWAPDBHAMSWAPDBWAMSWAPDBVAMMAXDBWUAMMAXDBVUAMMINDBWUAMMINDBVUFTINTRPWFFTINTRPWDFTINTRPVFFTINTRPVDFTINTRMWFFTINTRMWDFTINTRMVFFTINTRMVDFTINTRZWFFTINTRZWDFTINTRZVFFTINTRZVDFNMADDSCCFNMSUBSCCFRSQRTECCVCMPNEBCCVCMPNEHCCVCMPNEWCCVSHASIGMAXSCVDPSPNXSCVSPDPNXSCVSXDDPXSCVUXDDPXSCVSXDSPXSCVUXDSPXVCVSXDDPXVCVSXWDPXVCVUXDDPXVCVUXWDPXVCVSXDSPXVCVSXWSPXVCVUXDSPXVCVUXWSPXXSETACCZXVI16GER2XVF16GER2XSCVQPUQZXSCVQPSQZXSCMPGTQPXSCMPGEQPXSCMPEQQPVSTRIHRCCVSTRIHLCCVSTRIBRCCVSTRIBLCCVEXTDDVRXVEXTDDVLXVEXPANDWMVEXPANDQMVEXPANDHMVEXPANDDMVEXPANDBMXXSPLTIDPXXBLENDVWXXBLENDVHXXBLENDVDXXBLENDVBVLUXEI16VVLUXEI32VVLUXEI64VVLOXEI16VVLOXEI32VVLOXEI64VVSUXEI16VVSUXEI32VVSUXEI64VVSOXEI16VVSOXEI32VVSOXEI64VVMULHSUVVVMULHSUVXVWMULSUVVVWMULSUVXVWMACCUVVVWMACCUVXVMERGEVVMVMERGEVXMVMERGEVIMVNCLIPUWVVNCLIPUWXVNCLIPUWIVFNMACCVVVFNMACCVFVFNMSACVVVFNMSACVFVFNMADDVVVFNMADDVFVFNMSUBVVVFNMSUBVFVFWMACCVVVFWMACCVFVFWMSACVVVFWMSACVFVFRSQRT7VVFSGNJNVVVFSGNJNVFVFSGNJXVVVFSGNJXVFVFCVTXUFVVFCVTFXUVVFWCVTXFVVFWCVTFXVVFWCVTFFVVFNCVTXFWVFNCVTFXWVFNCVTFFWVREDSUMVSVREDMAXVSVREDMINVSVREDANDVSVREDXORVSSFENCEVMARDINSTRETprog: %v
UnorderedGlobalGetGlobalSetI32Load8SI32Load8UI32Store8I32PopcntTableInitTableCopyTableGrowTableSizeTableFillRETUNWINDmemeqbodyDDotrahd;DotEqual;Integral;LessLess;NotEqual;NotTilde;PartialD;Precedes;RightTee;Succeeds;SuchThat;Superset;Uarrocir;UnderBar;andslope;angmsdaa;angmsdab;angmsdac;angmsdad;angmsdae;angmsdaf;angmsdag;angmsdah;angrtvbd;approxeq;awconint;backcong;barwedge;bbrktbrk;bigoplus;bigsqcup;biguplus;bigwedge;boxminus;boxtimes;bsolhsub;capbrcup;circledR;circledS;cirfnint;clubsuit;cupbrcap;curlyvee;cwconint;doteqdot;dotminus;drbkarow;dzigrarr;elinters;emptyset;eqvparsl;fpartint;geqslant;gesdotol;gnapprox;hksearow;hkswarow;imagline;imagpart;infintie;integers;intercal;intlarhk;laemptyv;ldrushar;leqslant;lesdotor;llcorner;lnapprox;lrcorner;lurdshar;mapstoup;multimap;naturals;otimesas;parallel;plusacir;pointint;precneqq;precnsim;profalar;profline;profsurf;raemptyv;realpart;rppolint;rtriltri;scpolint;setminus;shortmid;smeparsl;sqsubset;sqsupset;subseteq;succneqq;succnsim;supseteq;thetasym;thicksim;timesbar;triangle;triminus;trpezium;ulcorner;urcorner;varkappa;varsigma;vartheta;ncongdot;notindot;rwxrwxrwxBigEndianAccuracy(underflowunhandledInheritedBassa_VahBhaiksukiCuneiformKhudawadiMalayalamMongolianNabataeanPalmyreneSamaritanSundanesetype:int8type:boolpclmulqdq#execwait/dev/null				ctrl  (empty)
				key  				elem math/randtlsrsakexOperator(expected if clausesemicolon_Ciconst__Cfconst__Csconst_%v failed%s:%d: %s%s:	%s%s
implement-- %s: %scycle to #tmpStateInstMatchInstRune1[:alnum:][:alpha:][:ascii:][:blank:][:cntrl:][:digit:][:graph:][:lower:][:print:][:punct:][:space:][:upper:][:^word:]d.nx != 0counter: bad cas32%s.%s:%+d%s.%s:=%dtelemetryLocations%6d: %#x cSHAKE128R%d%c%cR%dgo.builtingo:builtingo.runtimebad writer..inittask.blockprof.mutexprofMulUintptrStorepNoWBStoreRel64Storeint32Storeint64CasuintptrAnduintptrRotateLeftOnesCount8LoadUint32LoadUint64StoreInt32StoreInt64SwapUint32SwapUint64AddUintptrAndUintptrassertE2I2panicshifttypeAssertpanicIndexwasmTruncSwasmTruncU.opendeferopen-codedfint32to32f32toint32fint64to32f32toint64fint32to64f64toint32fint64to64f64toint64genssa %s
,softfloat,hardfloat%s.power%d/dev/stdinreaddirent (deleted)pidfd_openpidfd_waitAESDECLASTAESENCLASTCLFLUSHOPTCMPXCHG16BPHMINPOSUWPREFETCHT0PREFETCHT1PREFETCHT2PUNPCKHQDQPUNPCKLQDQSHA256MSG1SHA256MSG2SYSENTER64V4FNMADDPSV4FNMADDSSVCVTPD2DQXVCVTPD2DQYVCVTPD2PSXVCVTPD2PSYVCVTPD2UDQVCVTPD2UQQVCVTPS2UDQVCVTPS2UQQVCVTQQ2PSXVCVTQQ2PSYVCVTSD2SIQVCVTSD2USIVCVTSI2SDLVCVTSI2SDQVCVTSI2SSLVCVTSI2SSQVCVTSS2SIQVCVTSS2USIVCVTTPD2DQVCVTTPD2QQVCVTTPS2DQVCVTTPS2QQVCVTTSD2SIVCVTTSS2SIVCVTUDQ2PDVCVTUDQ2PSVCVTUQQ2PDVCVTUQQ2PSVCVTUSI2SDVCVTUSI2SSVEXTRACTPSVFPCLASSPDVFPCLASSPSVFPCLASSSDVFPCLASSSSVGATHERDPDVGATHERDPSVGATHERQPDVGATHERQPSVGETMANTPDVGETMANTPSVGETMANTSDVGETMANTSSVGF2P8MULBVMASKMOVPDVMASKMOVPSVP4DPWSSDSVPCLMULQDQVPCMPESTRIVPCMPESTRMVPCMPISTRIVPCMPISTRMVPERM2F128VPERM2I128VPGATHERDDVPGATHERDQVPGATHERQDVPGATHERQQVPMADDUBSWVPMASKMOVDVPMASKMOVQVPTERNLOGDVPTERNLOGQVPUNPCKHBWVPUNPCKHDQVPUNPCKHWDVPUNPCKLBWVPUNPCKLDQVPUNPCKLWDVRSQRT14PDVRSQRT14PSVRSQRT14SDVRSQRT14SSVRSQRT28PDVRSQRT28PSVRSQRT28SDVRSQRT28SSVSHUFF32X4VSHUFF64X2VSHUFI32X4VSHUFI64X2VZEROUPPERXSAVEOPT64unsafe.Add%.v := %.vreturn %.vinlmark %d%v(%v, %v)%v(%.v...) curfn(%p) outer(%p).deferwrapMarkNonNilNewBranch complex128linksymfmtmap.group[nil symboltyp is nilcomparableABIWRAPPERPCALIGNMAXgo:string.gclocals·pctoinlinepctopcdata<nil Prog>(%v)(NONE)%s%s%s(%s)%s@GOT(%s)%s<>%s(%s)late lowercheckLowermemcombineBlockStartMOVSSconstMOVSDconstMOVSSstoreMOVSDstoreTESTLconstTESTWconstTESTBconstADDLmodifySUBLmodifyANDLmodifyXORLmodifyCALLstaticFlagLT_ULTFlagLT_UGTFlagGT_UGTFlagGT_ULTSUBQborrowTESTQconstADDQmodifySUBQmodifyANDQmodifyXORQmodifySETEQstoreSETNEstoreSETLEstoreSETGEstoreSETBEstoreSETAEstorePrefetchT0MOVBELloadMOVBEQloadADDshiftLLADDshiftRLADDshiftRASUBshiftLLSUBshiftRLSUBshiftRARSBshiftLLRSBshiftRLRSBshiftRAANDshiftLLANDshiftRLANDshiftRAXORshiftLLXORshiftRLXORshiftRAXORshiftRRBICshiftLLBICshiftRLBICshiftRAMVNshiftLLMVNshiftRLMVNshiftRAADCshiftLLADCshiftRLADCshiftRASBCshiftLLSBCshiftRLSBCshiftRARSCshiftLLRSCshiftRLRSCshiftRACMPshiftLLCMPshiftRLCMPshiftRACMNshiftLLCMNshiftRLCMNshiftRATSTshiftLLTSTshiftRLTSTshiftRATEQshiftLLTEQshiftRLTEQshiftRALessEqualUEXTRWconstMVNshiftRONEGshiftLLNEGshiftRLNEGshiftRAANDshiftROXORshiftROBICshiftROEONshiftLLEONshiftRLEONshiftRAEONshiftROORNshiftLLORNshiftRLORNshiftRAORNshiftROTSTshiftROFMOVSconstFMOVDconstFMOVSstoreFMOVDstoreLessEqualFROTRVconstFPFlagTrueADDCCconstSUBFCconstMULLDconstMULLWconstROTLWconstANDCCconstMOVDBRloadMOVWBRloadMOVHBRloadCMPWUconstFLessEqualFMOVWstoreI64Load16UI64Load16SI64Load32UI64Load32SI64Store16I64Store32F32NearestF64NearestMul32uhiloMul64uhiloMul32uoverMul64uoverCondSelectPopCount16PopCount32PopCount64ConstSliceSPanchoredStaticCallTailLECallTrunc16to8Trunc32to8Trunc64to8Cvt32to32FCvt32to64FCvt64to32FCvt64to64FCvt32Fto32Cvt32Fto64Cvt64Fto32Cvt64Fto64IsInBoundsStringMakeStructMakeArrayMake0ArrayMake1Add32carrySub32carryAdd64carryMakeResultAtomicAnd8AtomicOr32PubBarrierClobberRegearly fusebranchelimisInBounds0x%x.%d.%d(no vars)
%s %s = %ssvg_graph_dead-blockdead-valuehdr:%s%s%sloopstats:(%d):%d:%dCLOBBERS:
AuxCall{%vempty root	label=%q
%s %s (%s)  %s: v%d
 [use %s]
auto_slotsbad fst %vUAUTO4K_16UAUTO8K_16UAUTO16K_8UOREG4K_16UOREG8K_16UOREG16K_8AMCFGR_EL0AMCGCR_EL0CCSIDR_EL1CNTFRQ_EL0CNTPCT_EL0CNTVCT_EL0CSSELR_EL1DBGDTR_EL0ERRIDR_EL1MDCCSR_EL0OSECCR_EL1PMBIDR_EL1PMBPTR_EL1PMSELR_EL0PMSFCR_EL1PMSICR_EL1PMSIDR_EL1PMSIRR_EL1REVIDR_EL1TFSRE0_EL1bad sxt %vbadreg(%d)notifyListprofInsertstackLargeNot workermSpanInUseGOMAXPROCSstop tracedisablethpinvalidptrschedtracesemacquiredebug call flushGen  MB goal, s.state =  s.base()= heapGoal=GOMEMLIMIT KiB now,  pages at  sweepgen= sweepgen , bound = , limit =  returned ,errno=0}
Bad varintGC forced
 runqueue= stopwait= runqsize= gfreecnt= throwing= spinning=atomicand8float64nanfloat32nan ptrSize=  targetpc= until pc=active < 0unknown pcruntime: ggoroutine  for type t.Kind == asmcgocallconcurrentRelocType(12207031256103515625ParseFloatowner diedterminated/setgroups%!Weekday(short readnot staticmapaccess1mapaccess2assignmentcountrunesmakechan64printefaceprintifaceprintsliceprintfloatconvTsliceconvTnoptrgo:"track"decoderune(%s + %si)memequal16memequal32memequal64interequalmemhash128addCovMetaStringDatacountervarescAnalyzeaddress-ofexpressionmoduleNamegenhash %vgeneq bodyoldbucketsBucketSizegrowthLeftlocalDepthTypeSym %vcontentionFTINTRNEWFFTINTRNEWDFTINTRNEVFFTINTRNEVDEXTSWSLICCVCMPEQUBCCVCMPEQUHCCVCMPEQUWCCVCMPEQUDCCVCMPGTUBCCVCMPGTUHCCVCMPGTUWCCVCMPGTUDCCVCMPGTSBCCVCMPGTSHCCVCMPGTSWCCVCMPGTSDCCVCMPNEZBCCVSHASIGMAWVSHASIGMADXSCVDPSXDSXSCVDPSXWSXSCVDPUXDSXSCVDPUXWSXVCVDPSXDSXVCVDPSXWSXVCVDPUXDSXVCVDPUXWSXVCVSPSXDSXVCVSPSXWSXVCVSPUXDSXVCVSPUXWSXXGENPCVWMXXGENPCVHMXXGENPCVDMXXGENPCVBMXVI8GER4PPXVI4GER8PPXVI16GER2SXVF64GERPPXVF64GERPNXVF64GERNPXVF64GERNNXVF32GERPPXVF32GERPNXVF32GERNPXVF32GERNNXVCVSPBF16XVBF16GER2VEXTRACTWMVEXTRACTQMVEXTRACTHMVEXTRACTDMVEXTRACTBMVEXTDUWVRXVEXTDUWVLXVEXTDUHVRXVEXTDUHVLXVEXTDUBVRXVEXTDUBVLXVCMPGTUQCCVCMPGTSQCCVCMPEQUQCCPMXVI8GER4PMXVI4GER8PMXVF64GERPMXVF32GERVWMACCSUVVVWMACCSUVXVWMACCUSVXVFWNMACCVVVFWNMACCVFVFWNMSACVVVFWNMSACVFVFMERGEVFMVFWCVTXUFVVFWCVTFXUVVFNCVTXUFWVFNCVTFXUWVREDMAXUVSVREDMINUVSVWREDSUMVSVFREDMAXVSVFREDMINVSVSLIDEUPVXVSLIDEUPVIVRGATHERVVVRGATHERVXVRGATHERVINotGreaterIN %d: %s
I32Load16SI32Load16UI32Store16GrowMemoryI32WrapI64MemoryInitMemoryCopyMemoryFillBackslash;CenterDot;CircleDot;Congruent;Coproduct;DoubleDot;DownArrow;DownBreve;Downarrow;HumpEqual;LeftArrow;LeftFloor;Leftarrow;LessTilde;Mellintrf;MinusPlus;NotCupCap;NotExists;OverBrace;PlusMinus;Therefore;ThinSpace;TripleDot;UnionPlus;backprime;backsimeq;bigotimes;centerdot;checkmark;complexes;dotsquare;downarrow;gtrapprox;gtreqless;heartsuit;leftarrow;lesseqgtr;nparallel;nshortmid;nsubseteq;nsupseteq;pitchfork;rationals;spadesuit;subseteqq;subsetneq;supseteqq;supsetneq;therefore;triangleq;varpropto;NotSubset;gvertneqq;lvertneqq;ngeqslant;nleqslant;impossibleChorasmianDevanagariGlagoliticKharoshthiManichaeanOld_ItalicOld_PermicOld_TurkicOld_UyghurPhoenicianSaurashtratype:*int8type:uint8type:int16type:int32type:int64type:*booltype:errorexecerrdot
	groups:
http2debugrsa1024mincrypto/rsacrypto/tlswinsymlinkx509rsacrtmemequal%dunexpectedParamFlagsno clauses%s  %d %s
//go:buildexpected =for clause<bad expr>not enough=> %s (%s)type alias-- expr %spackage %s parameterpackage %qinterface{-- type %sgo object [:^alnum:][:^alpha:][:^ascii:][:^blank:][:^cntrl:][:^digit:][:^graph:][:^lower:][:^print:][:^punct:][:^space:][:^upper:][:xdigit:]rune <nil>rotate: %v2006-01-02Period: %dbad varintCounterKDFcompile/bugloopvarhashmergelocals [DISABLED]unknown ABIunaccounted    %.2f %%go.coveragesmallframesunreachableGetCallerPCGetCallerSPLoaduintptrXchguintptrXadduintptrRoundToEvenRotateLeft8OnesCount64OnesCount32OnesCount16sync/atomicLoadPointerLoadUintptrStoreUint32StoreUint64SwapUintptrbitsetFirstdeferprocatdeferreturnpanicdividex86HasSSE41armHasVFPv4panicIndexUpanicSliceB.closureptrfuint64to32f32touint64fuint64to64f64touint64%s.wrapinfo/dev/stdout/dev/stderrPREFETCHNTASHA256RNDS2VAESDECLASTVAESENCLASTVCOMPRESSPDVCOMPRESSPSVCVTPD2UDQXVCVTPD2UDQYVCVTSD2USILVCVTSD2USIQVCVTSS2USILVCVTSS2USIQVCVTTPD2DQXVCVTTPD2DQYVCVTTPD2UDQVCVTTPD2UQQVCVTTPS2UDQVCVTTPS2UQQVCVTTSD2SIQVCVTTSD2USIVCVTTSS2SIQVCVTTSS2USIVCVTUQQ2PSXVCVTUQQ2PSYVCVTUSI2SDLVCVTUSI2SDQVCVTUSI2SSLVCVTUSI2SSQVFIXUPIMMPDVFIXUPIMMPSVFIXUPIMMSDVFIXUPIMMSSVFMADD132PDVFMADD132PSVFMADD132SDVFMADD132SSVFMADD213PDVFMADD213PSVFMADD213SDVFMADD213SSVFMADD231PDVFMADD231PSVFMADD231SDVFMADD231SSVFMSUB132PDVFMSUB132PSVFMSUB132SDVFMSUB132SSVFMSUB213PDVFMSUB213PSVFMSUB213SDVFMSUB213SSVFMSUB231PDVFMSUB231PSVFMSUB231SDVFMSUB231SSVFPCLASSPDXVFPCLASSPDYVFPCLASSPDZVFPCLASSPSXVFPCLASSPSYVFPCLASSPSZVINSERTF128VINSERTI128VMASKMOVDQUVPCOMPRESSBVPCOMPRESSDVPCOMPRESSQVPCOMPRESSWVPCONFLICTDVPCONFLICTQVPHMINPOSUWVPMADD52HUQVPMADD52LUQVPSCATTERDDVPSCATTERDQVPSCATTERQDVPSCATTERQQVPUNPCKHQDQVPUNPCKLQDQVRNDSCALEPDVRNDSCALEPSVRNDSCALESDVRNDSCALESSVSCATTERDPDVSCATTERDPSVSCATTERQPDVSCATTERQPSbad SPWRITEfallthroughtailcall %v(%v)(%s@%d)BoolVal(%v)untyped intinterface {map.bucket[GETCALLERPC.typeAssert%v %s (%v)
symbol: %s
<idx %d %d>%6x %6d %v
%6x %6s %v
$f32.%08x%s$i32.%08x%s__unnamed__go compilergeneric csephi tightenlowered cseloop rotateORLloadidx4MOVBLSXloadMOVWLSXloadCALLclosureInvertFlagsLoweredGetGMOVSSconst1MOVSDconst1MOVSSconst2MOVSDconst2ORLloadidx1ORLloadidx8ORQloadidx1ORQloadidx8MOVBQSXloadMOVWQSXloadMOVLQSXloadPrefetchNTAMOVBEWstoreMOVBELstoreMOVBEQstoreADDSshiftLLADDSshiftRLADDSshiftRASUBSshiftLLSUBSshiftRLSUBSshiftRARSBSshiftLLRSBSshiftRLRSBSshiftRAMOVWloadidxMOVBloadidxMOVHloadidxGreaterThanLoweredZeroLoweredMoveMOVDloadidxMOVVloadidxMOVFloadidxFPFlagFalseMOVDBRstoreMOVWBRstoreMOVHBRstoreMOVDaddridxLoweredAddrI64AddConstI64Extend8SF32CopysignF64CopysignCtz8NonZeroConstStringArgFloatRegDereferencePanicBoundsPanicExtendClosureCallInterLECallTrunc32to16Trunc64to16Trunc64to32Cvt32Fto64FCvt64Fto32FComplexMakeComplexRealComplexImagArraySelectSub64borrowCvt32Uto32FCvt32Uto64FCvt32Fto32UCvt64Fto32UCvt64Uto32FCvt64Uto64FCvt32Fto64UCvt64Fto64USelectNAddrAtomicLoad8AtomicAdd32AtomicAdd64AtomicAnd32 (unlikely)	%s	%s%s	%sdot: %v
%v
AuxCall{nilafter phis
shuffle %s
v%d: %s %s
named_slots%v is moved<NIL VALUE>SBIT = 1<<4PBIT = 1<<5WBIT = 1<<6FBIT = 1<<7UBIT = 1<<7UAUTO16K_16UAUTO32K_16UOREG16K_16UOREG32K_16CCSIDR2_EL1CNTKCTL_EL1DBGBCR0_EL1DBGBCR1_EL1DBGBCR2_EL1DBGBCR3_EL1DBGBCR4_EL1DBGBCR5_EL1DBGBCR6_EL1DBGBCR7_EL1DBGBCR8_EL1DBGBCR9_EL1DBGBVR0_EL1DBGBVR1_EL1DBGBVR2_EL1DBGBVR3_EL1DBGBVR4_EL1DBGBVR5_EL1DBGBVR6_EL1DBGBVR7_EL1DBGBVR8_EL1DBGBVR9_EL1DBGPRCR_EL1DBGWCR0_EL1DBGWCR1_EL1DBGWCR2_EL1DBGWCR3_EL1DBGWCR4_EL1DBGWCR5_EL1DBGWCR6_EL1DBGWCR7_EL1DBGWCR8_EL1DBGWCR9_EL1DBGWVR0_EL1DBGWVR1_EL1DBGWVR2_EL1DBGWVR3_EL1DBGWVR4_EL1DBGWVR5_EL1DBGWVR6_EL1DBGWVR7_EL1DBGWVR8_EL1DBGWVR9_EL1ERRSELR_EL1ERXADDR_EL1ERXCTLR_EL1ERXPFGF_EL1ICC_DIR_EL1ICC_PMR_EL1ICC_RPR_EL1ICC_SRE_EL1ICV_DIR_EL1ICV_PMR_EL1ICV_RPR_EL1ID_AFR0_EL1ID_DFR0_EL1ID_PFR0_EL1ID_PFR1_EL1ID_PFR2_EL1MDCCINT_EL1MPAMIDR_EL1OSDTRRX_EL1OSDTRTX_EL1PMCCNTR_EL0PMCEID0_EL0PMCEID1_EL0PMSEVFR_EL1PMSWINC_EL0SCXTNUM_EL0SCXTNUM_EL1TPIDRRO_EL0%s.UXTB<<%d%s.UXTH<<%d%s.UXTW<<%d%s.UXTX<<%d%s.SXTB<<%d%s.SXTH<<%d%s.SXTW<<%d%s.SXTX<<%dassistQueuenetpollInitreflectOffsglobalAllocmSpanManualstart traceclobberfreegccheckmarkscheddetailunspecifiedcgocall nil s.nelems=   of size  ) returned runtime: p  ms clock,  nBSSRoots=runtime: P  exp.) for minTrigger=GOMEMLIMIT=bad m value, elemsize= freeindex= span.list=, npages = , a123456=[ p->status= in status  idleprocs= gcwaiting= schedtick= timerslen= mallocing=bad timedivfloat64nan1float64nan2float64nan3float32nan2GOTRACEBACK (targetpc=runtime: g ) at entry+ , plugin: running < 0: frame.sp=created by MarshalJSONMarshalTextparse errorbad argSizemethodargs(reflect.SetcgocallbackdebugCallV2systemstackshort write30517578125bad addressfile existsbroken pipebad messagealarm clockstack faulttime: file randseednopcall to %s:bb#%d pred=makeslice64printstringprintunlockconvTstringconcatbytesusefield %vselect casemapIterNextmapiterinitmapiternextselectsetpcmayCall %+vconcatbyte2concatbyte3concatbyte4concatbyte5typedmemclrmemequal128bad type %v.autotmp_%dfield valueOITAB of %vOSPTR of %vfinal tokenindirectionrange-derefswitch caseassign-pair.3clNext_%dgo:generatedeclaration.hashfunc%doldoverflowstartBucketcheckBucketgroups_dataglobalDepthglobalShiftFieldAlign_.gobytes.%dnanosecondsalloc_space# Sys = %d
contentionsinuse_spaceVCIPHERLASTXVI8GER4SPPXVI16GER2PPXVF16GER2PPXVF16GER2PNXVF16GER2NPXVF16GER2NNXVCVBF16SPNXXSPLTI32DXPMXVI16GER2PMXVF16GER2VFCVTRTZXFVVWREDSUMUVSVFREDOSUMVSVFREDUSUMVSVSLIDE1UPVXVCOMPRESSVMLessOrEqualspilloffsetOUT %d: %s
UnreachableI32Extend8SRESUMEPOINTbad Br/BrIfBernoullis;CirclePlus;EqualTilde;Fouriertrf;ImaginaryI;Laplacetrf;LeftVector;Lleftarrow;NotElement;NotGreater;Proportion;RightArrow;RightFloor;Rightarrow;TildeEqual;TildeTilde;UnderBrace;UpArrowBar;UpTeeArrow;circledast;complement;curlywedge;eqslantgtr;gtreqqless;lessapprox;lesseqqgtr;lmoustache;longmapsto;mapstodown;mapstoleft;nLeftarrow;nleftarrow;precapprox;rightarrow;rmoustache;sqsubseteq;sqsupseteq;subsetneqq;succapprox;supsetneqq;upuparrows;varepsilon;varnothing;ThickSpace;nsubseteqq;nsupseteqq;i/o timeoutDives_AkuruMedefaidrinNag_MundariNandinagariNew_Tai_LueOld_PersianOld_SogdianPau_Cin_HauSignWritingWarang_Cititype:*uint8type:*int16type:uint16type:*int32type:uint32type:*int64type:uint64type:stringtype:*error bytes ...
 (deleted)
gocachehashgocachetesthttp2clienthttp2serverarchive/tartls10servercrypto/x509archive/zip%sFlags %s
ResultFlagsSyncMarker((Node @ %d)struct typeassignment I/O error: hexadecimal_Cfpvar_fp_subtractionbitwise XORuntyped nilbuilt-in %sempty unionmap literalis not used=> %s // %sInstCaptureInstRuneAny[:^xdigit:]
truncated
CGO_ENABLED<unlinkable>HASH_EXCLUDEGSHS_LOGFILEsyntax error    %d ns/opcompilefuncsbuild id %q

$$  // cgo
-symabis: %vStoreuintptrRotateLeft16RotateLeft32RotateLeft64StoreUintptrracefuncexitx86HasPOPCNTtypedmemmovewriteBarriergoPanicIndexpanicSliceBUpanicSlice3BpanicSlice3C%s.arginfo%dGOEXPERIMENTexit status can't happenVBROADCASTSDVBROADCASTSSVCVTTPD2UDQXVCVTTPD2UDQYVCVTTSD2USILVCVTTSD2USIQVCVTTSS2USILVCVTTSS2USIQVEXTRACTF128VEXTRACTI128VFNMADD132PDVFNMADD132PSVFNMADD132SDVFNMADD132SSVFNMADD213PDVFNMADD213PSVFNMADD213SDVFNMADD213SSVFNMADD231PDVFNMADD231PSVFNMADD231SDVFNMADD231SSVFNMSUB132PDVFNMSUB132PSVFNMSUB132SDVFNMSUB132SSVFNMSUB213PDVFNMSUB213PSVFNMSUB213SDVFNMSUB213SSVFNMSUB231PDVFNMSUB231PSVFNMSUB231SDVFNMSUB231SSVINSERTF32X4VINSERTF32X8VINSERTF64X2VINSERTF64X4VINSERTI32X4VINSERTI32X8VINSERTI64X2VINSERTI64X4VPBROADCASTBVPBROADCASTDVPBROADCASTQVPBROADCASTWVPSHUFBITQMB<bad suffix>runtime.duffbad addr: %vunsafe.Slicemissing typeType.Elem %s%%!%c(Op=%d)%v (type %v)if %v { %v } else { %v }%v statementfunc literal... argumentmake(%v, %v)%%!%c(Nodes) fnName(%+v)Int64Val(%v)untyped booluntyped runeinterface {}bad type: %vCalcSize anyCheckSize %v.argliveinfobad startPosABIInternal|$f64.%016x%s$i64.%016x%sgclocals·%s%.5d (%v)	%s%s%s@GOT(%s)nilcheckelimexpand callsBlockInvalidADDLloadidx4SUBLloadidx4MULLloadidx4ANDLloadidx4XORLloadidx4LoweredCtz32LoweredCtz64MOVBloadidx1MOVWloadidx1MOVWloadidx2MOVLloadidx1MOVLloadidx4CMPQloadidx8CMPQloadidx1CMPLloadidx4CMPLloadidx1CMPWloadidx2CMPWloadidx1CMPBloadidx1ADDLloadidx1ADDLloadidx8ADDQloadidx1ADDQloadidx8SUBLloadidx1SUBLloadidx8SUBQloadidx1SUBQloadidx8ANDLloadidx1ANDLloadidx8ANDQloadidx1ANDQloadidx8XORLloadidx1XORLloadidx8XORQloadidx1XORQloadidx8MOVLloadidx8MOVQloadidx1MOVQloadidx8CMPXCHGLlockCMPXCHGQlockORshiftLLregORshiftRLregORshiftRAregMOVBUloadidxMOVHUloadidxMOVWstoreidxMOVBstoreidxMOVHstoreidxCMOVWHSconstCMOVWLSconstGreaterEqualGreaterThanUFlagConstantADCzerocarryNGCzerocarryMOVWUloadidxFMOVSloadidxFMOVDloadidxMOVHloadidx2MOVWloadidx4MOVDloadidx8MOVDstoreidxGreaterThanFNotLessThanFLessThanNoovMOVVstoreidxMOVFstoreidxEXTSWSLconstMOVBZloadidxMOVHZloadidxMOVWZloadidxFGreaterThanLoweredFMAXSLoweredFMINSLoweredFMINDLoweredFMAXDF32DemoteF64I64Extend16SI64Extend32SCtz16NonZeroCtz32NonZeroCtz64NonZeroStaticLECallSignExt8to16SignExt8to32SignExt8to64ZeroExt8to16ZeroExt8to32ZeroExt8to64StructSelectSpectreIndexAtomicLoad32AtomicLoad64AtomicStore8number lineszero arg cseopt deadcodewritebarrierlikelyadjustbad size %d
CSE REWRITESmissing_pass</pre></div>always_callsname %s: %v
relation(%d)edge %s->%s
dst %s: v%d
reused_slotsruntime._divruntime._modCNTP_CTL_EL0CNTV_CTL_EL0DBGBCR10_EL1DBGBCR11_EL1DBGBCR12_EL1DBGBCR13_EL1DBGBCR14_EL1DBGBCR15_EL1DBGBVR10_EL1DBGBVR11_EL1DBGBVR12_EL1DBGBVR13_EL1DBGBVR14_EL1DBGBVR15_EL1DBGDTRRX_EL0DBGDTRTX_EL0DBGWCR10_EL1DBGWCR11_EL1DBGWCR12_EL1DBGWCR13_EL1DBGWCR14_EL1DBGWCR15_EL1DBGWVR10_EL1DBGWVR11_EL1DBGWVR12_EL1DBGWVR13_EL1DBGWVR14_EL1DBGWVR15_EL1ERXMISC0_EL1ERXMISC1_EL1ERXMISC2_EL1ERXMISC3_EL1ICC_BPR0_EL1ICC_BPR1_EL1ICC_CTLR_EL1ICC_IAR0_EL1ICC_IAR1_EL1ICV_BPR0_EL1ICV_BPR1_EL1ICV_CTLR_EL1ICV_IAR0_EL1ICV_IAR1_EL1ID_ISAR0_EL1ID_ISAR1_EL1ID_ISAR2_EL1ID_ISAR3_EL1ID_ISAR4_EL1ID_ISAR5_EL1ID_ISAR6_EL1ID_MMFR0_EL1ID_MMFR1_EL1ID_MMFR2_EL1ID_MMFR3_EL1ID_MMFR4_EL1PMOVSCLR_EL0PMOVSSET_EL0PMSLATFR_EL1sweepWaiterstraceStringsspanSetSpinemspanSpecialtraceTypeTabgcBitsArenasmheapSpecialgcpacertraceharddecommitmadvdontneeddumping heapchan receivesynctest.Runlfstack.push span.limit= span.state=bad flushGen MB stacks, worker mode  nDataRoots= nSpanRoots= wbuf1=<nil> wbuf2=<nil> gcscandone runtime: gp= found at *( s.elemsize= B (∆goal , cons/mark  maxTrigger= pages/byte
 s.sweepgen= allocCount timer_deletens} value: {}, want {r1= [recovered]bad recoveryGOTRACEBACK=bad g statusentersyscallwirep: p->m=) p->status=releasep: m= sysmonwait= preemptoff=cas64 failed m->gsignal=-byte limit
runtime: sp=abi mismatchwrong timersbuild	%s=%s
 has no name has no typeinternal/abiinternal/cpuruntime/raceruntime/msanruntime/asanasyncPreemptHeadType(%d)short buffer152587890625762939453125illegal seekinvalid slothost is downchild exitedI/O possiblerandautoseed=-= iuetab:
entry to %s:printuintptrprintpointerprintcomplexslicelit: %vconcatbyte%dmapIterStartselectnbsendselectnbrecvmkcall %v %vnilinterhashtypecheck %vcannot %s %vcopied slicego:linkname .asanglobalsodrIndicatorgenhash bodywriteType %vembed %s: %vthreadcreateVNCIPHERLASTXVI16GER2SPPXVBF16GER2PPXVBF16GER2PNXVBF16GER2NPXVBF16GER2NNPMXVI8GER4PPPMXVI4GER8PPPMXVI16GER2SPMXVF64GERPPPMXVF64GERPNPMXVF64GERNPPMXVF64GERNNPMXVF32GERPPPMXVF32GERPNPMXVF32GERNPPMXVF32GERNNPMXVBF16GER2runtime.elf_VFCVTRTZXUFVVFWCVTRTZXFVVFNCVTRTZXFWVFNCVTRODFFWVFWREDOSUMVSVFWREDUSUMVSVSLIDEDOWNVXVSLIDEDOWNVIVFSLIDE1UPVFNotUnorderedCallIndirectI32TruncF32SI32TruncF32UI32TruncF64SI32TruncF64UI64TruncF32SI64TruncF32UI64TruncF64SI64TruncF64UI32Extend16SCALLNORESUME_rt0_wasm_jsbad MOV namebad MOV typeCircleMinus;CircleTimes;Equilibrium;GreaterLess;LeftCeiling;LessGreater;MediumSpace;NotPrecedes;NotSucceeds;OverBracket;RightVector;Rrightarrow;RuleDelayed;SmallCircle;SquareUnion;SubsetEqual;UpDownArrow;Updownarrow;VerticalBar;backepsilon;blacksquare;circledcirc;circleddash;curlyeqprec;curlyeqsucc;diamondsuit;eqslantless;expectation;nRightarrow;nrightarrow;preccurlyeq;precnapprox;quaternions;straightphi;succcurlyeq;succnapprox;thickapprox;updownarrow;NotLessLess;NotSuperset;not pollableLittleEndianinvalid baseCypro_MinoanMeetei_MayekPahawh_HmongSora_SompengSyloti_Nagriruntime.randtype:*uint16type:*uint32type:*uint64type:float32type:float64type:uintptrtype:*string
	capacity: gotypesaliashttpmuxgo121multipathtcptlsunsafeekmcgo functioninvalid type (truncated) (overflows)unknown typeempty stringmethod expr range clauseno core type /* package InstAltMatchunexpected )altmatch -> anynotnl -> Add %q += %dDuration: %v^/[/*][ \t]*unknown size/dev/urandombad load typecompile/flag:-embedcfg: %vafter walk %vgo:wasmimportgo:wasmexportGetClosurePtrpanicdottypeEpanicdottypeIpanicoverflowracefuncenterracereadrangeloong64HasLSXstaticuint64sgoPanicIndexUgoPanicSliceBpanicSlice3BUpanicSlice3CUnot reachablebuildssa-body%v not a Boolgoexperiment.stop signal: VEXTRACTF32X4VEXTRACTF32X8VEXTRACTF64X2VEXTRACTF64X4VEXTRACTI32X4VEXTRACTI32X8VEXTRACTI64X2VEXTRACTI64X4VGATHERPF0DPDVGATHERPF0DPSVGATHERPF0QPDVGATHERPF0QPSVGATHERPF1DPDVGATHERPF1DPSVGATHERPF1QPDVGATHERPF1QPSruntime.tls_gfunction callunsafe.Stringreassigned %vNewNameAt nilwrite barrierUint64Val(%v)StringVal(%v)untyped floatelem mismatchREFLECTMETHODgo:constinfo.late nilcheckMOVSSloadidx1MOVSSloadidx4MOVSDloadidx1MOVSDloadidx8CMPLconstloadCMPWconstloadCMPBconstloadSBBLcarrymaskORLmodifyidx4MOVBstoreidx1MOVWstoreidx1MOVWstoreidx2MOVLstoreidx1MOVLstoreidx4ADDSSloadidx1ADDSSloadidx4ADDSDloadidx1ADDSDloadidx8SUBSSloadidx1SUBSSloadidx4SUBSDloadidx1SUBSDloadidx8MULSSloadidx1MULSSloadidx4MULSDloadidx1MULSDloadidx8DIVSSloadidx1DIVSSloadidx4DIVSDloadidx1DIVSDloadidx8CMPQconstloadORQmodifyidx1ORQmodifyidx8ORLmodifyidx1ORLmodifyidx8SBBQcarrymaskSETLstoreidx1SETGstoreidx1SETBstoreidx1SETAstoreidx1MOVLstoreidx8MOVQstoreidx1MOVQstoreidx8SARXLloadidx1SARXLloadidx4SARXLloadidx8SARXQloadidx1SARXQloadidx8SHLXLloadidx1SHLXLloadidx4SHLXLloadidx8SHLXQloadidx1SHLXQloadidx8SHRXLloadidx1SHRXLloadidx4SHRXLloadidx8SHRXQloadidx1SHRXQloadidx8ADDshiftLLregADDshiftRLregADDshiftRAregSUBshiftLLregSUBshiftRLregSUBshiftRAregRSBshiftLLregRSBshiftRLregRSBshiftRAregANDshiftLLregANDshiftRLregANDshiftRAregXORshiftLLregXORshiftRLregXORshiftRAregBICshiftLLregBICshiftRLregBICshiftRAregMVNshiftLLregMVNshiftRLregMVNshiftRAregADCshiftLLregADCshiftRLregADCshiftRAregSBCshiftLLregSBCshiftRLregSBCshiftRAregRSCshiftLLregRSCshiftRLregRSCshiftRAregCMPshiftLLregCMPshiftRLregCMPshiftRAregCMNshiftLLregCMNshiftRLregCMNshiftRAregTSTshiftLLregTSTshiftRLregTSTshiftRAregTEQshiftLLregTEQshiftRLregTEQshiftRAregGreaterEqualUMOVHUloadidx2MOVWUloadidx4FMOVSloadidx4FMOVDloadidx8FMOVSstoreidxFMOVDstoreidxMOVHstoreidx2MOVWstoreidx4MOVDstoreidx8MOVBstorezeroMOVHstorezeroMOVWstorezeroMOVDstorezeroMOVQstorezeroGreaterEqualFNotLessEqualFMOVVstorezeroMOVHBRloadidxMOVWBRloadidxMOVDBRloadidxFGreaterEqualF64PromoteF32HasCPUFeatureClosureLECallSignExt16to32SignExt16to64SignExt32to64ZeroExt16to32ZeroExt16to64ZeroExt32to64AtomicLoadPtrAtomicStore32AtomicStore64PrefetchCacheshort circuitgcse deadcodelate deadcodecompiling %s
<li>name %s: Loops in %s:
not lowered: val=%d,off=%dunimplemented [no source]
runtime._divuruntime._modubad shift: %vAMUSERENR_EL0APDAKeyHi_EL1APDAKeyLo_EL1APDBKeyHi_EL1APDBKeyLo_EL1APGAKeyHi_EL1APGAKeyLo_EL1APIAKeyHi_EL1APIAKeyLo_EL1APIBKeyHi_EL1APIBKeyLo_EL1CNTP_CVAL_EL0CNTP_TVAL_EL0CNTPS_CTL_EL1CNTV_CVAL_EL0CNTV_TVAL_EL0ERXPFGCDN_EL1ERXPFGCTL_EL1ERXSTATUS_EL1ICC_AP0R0_EL1ICC_AP0R1_EL1ICC_AP0R2_EL1ICC_AP0R3_EL1ICC_AP1R0_EL1ICC_AP1R1_EL1ICC_AP1R2_EL1ICC_AP1R3_EL1ICC_EOIR0_EL1ICC_EOIR1_EL1ICC_SGI0R_EL1ICC_SGI1R_EL1ICV_AP0R0_EL1ICV_AP0R1_EL1ICV_AP0R2_EL1ICV_AP0R3_EL1ICV_AP1R0_EL1ICV_AP1R1_EL1ICV_AP1R2_EL1ICV_AP1R3_EL1ICV_EOIR0_EL1ICV_EOIR1_EL1PMBLIMITR_EL1PMCCFILTR_EL0PMEVCNTR0_EL0PMEVCNTR1_EL0PMEVCNTR2_EL0PMEVCNTR3_EL0PMEVCNTR4_EL0PMEVCNTR5_EL0PMEVCNTR6_EL0PMEVCNTR7_EL0PMEVCNTR8_EL0PMEVCNTR9_EL0PMUSERENR_EL0PMXEVCNTR_EL0bad bit op
%vwakeableSleepprofMemActiveprofMemFuturetraceStackTabexecRInternaltestRInternalGC sweep waitsynctest.WaitSIGQUIT: quitSIGKILL: killout of memory is nil, not value method  span.base()=runtime: seq=bad flushGen , not pointer != sweepgen  MB globals,  work.nproc=  work.nwait=  nStackRoots= flushedWork double unlock s.spanclass= MB) workers=min too largeruntime: val=-byte block ( failed with timer_settimefatal error:  idlethreads= syscalltick=load64 failedxadd64 failedxchg64 failedmp.g0 stack [nil stackbase called from }
	sched={pc:, gp->status= pluginpath= : unknown pc runtime: pid==... setting.Usage of %s:
 (default %q) (default %v)internal/goosinternal/sync<%s>%s%d</%s>3814697265625invalid base level 3 resetexchange fulltimer expiredsrmount errorpower failure/etc/zoneinfoparsing time  out of range is too largeweird aux: %sliveness: %s

digraph G {
makemap_smallmakeslicecopyconcatstringscomplex128divorder.stmt %v%v not an Intconcatstring2concatstring3concatstring4concatstring5nilinterequalarray literalslice literalbad range endunhandled op too expensivego:cgo_ldflag.asanFilename in host name# Alloc = %d
# Frees = %d
# GCSys = %d
# NumGC = %d
alloc_objectsinuse_objectsPMXVI8GER4SPPPMXVI16GER2PPPMXVF16GER2PPPMXVF16GER2PNPMXVF16GER2NPPMXVF16GER2NNpower%d/%s/%sVFWCVTRTZXUFVVFNCVTRTZXUFWVSLIDE1DOWNVXLessOrGreaterInvalid (%#x)CurrentMemoryI64ExtendI32SI64ExtendI32Ubad framesizealign: bad opDownArrowBar;DownTeeArrow;ExponentialE;GreaterEqual;GreaterTilde;HilbertSpace;HumpDownHump;Intersection;LeftArrowBar;LeftTeeArrow;LeftTriangle;LeftUpVector;NotCongruent;NotLessEqual;NotLessTilde;Proportional;RightCeiling;RoundImplies;ShortUpArrow;SquareSubset;UnderBracket;VerticalLine;blacklozenge;exponentiale;risingdotseq;triangledown;triangleleft;NotHumpEqual;varsubsetneq;varsupsetneq;dalTLDpSugct?RoundingMode(Gunjala_GondiMasaram_GondiMende_KikakuiOld_Hungarianruntime.convTruntime.blocktype:*float32type:*float64type:*uintptrnot availablecrypto/subtlegocacheverifyinstallgoroothtml/templatetlsmaxrsasizeCSPropBits(0xexpected namefunction typeexpected typeargument list<<< ERROR: %snegative readundefined: %s== cleanup ==-- delayed %punexpected %Tprevious case%s redeclaredassign, exactinvalid UTF-8counter bug: type mismatch%s %s:%d s=%d             too much data#failfipscastHMAC-SHA2-256bad store typebad float sizeGOCOMPILEDEBUG-importcfg: %vLoadAcquintptrTrailingZeros8ReverseBytes64ReverseBytes32ReverseBytes16deferprocStackgoschedguardedracewriterangegoPanicSliceBUgoPanicSlice3BgoPanicSlice3CpanicSliceAlenpanicSliceAcapheap-allocated (core dumped)VBROADCASTF128VBROADCASTI128VFMADDSUB132PDVFMADDSUB132PSVFMADDSUB213PDVFMADDSUB213PSVFMADDSUB231PDVFMADDSUB231PSVFMSUBADD132PDVFMSUBADD132PSVFMSUBADD213PDVFMSUBADD213PSVFMSUBADD231PDVFMSUBADD231PSVGF2P8AFFINEQBVPMULTISHIFTQBVSCATTERPF0DPDVSCATTERPF0DPSVSCATTERPF0QPDVSCATTERPF0QPSVSCATTERPF1DPDVSCATTERPF1DPSVSCATTERPF1QPDVSCATTERPF1QPSunexpected: %vIsSlice3 op %vRHS is nil: %v<unnamed Func>outerfn is nilNewConstAt nilDeclaredBy niluntyped numberuntyped stringunsafe.Pointer.args_stackmapdata too largeMOVSSstoreidx1MOVSSstoreidx4MOVSDstoreidx1MOVSDstoreidx8ADDLconstcarrySUBLconstcarryADDLmodifyidx4SUBLmodifyidx4ANDLmodifyidx4XORLmodifyidx4ORLconstmodifyMOVBstoreconstMOVWstoreconstMOVLstoreconstADDQconstcarryORQconstmodifyADDQmodifyidx1ADDQmodifyidx8SUBQmodifyidx1SUBQmodifyidx8ANDQmodifyidx1ANDQmodifyidx8XORQmodifyidx1XORQmodifyidx8ADDLmodifyidx1ADDLmodifyidx8SUBLmodifyidx1SUBLmodifyidx8ANDLmodifyidx1ANDLmodifyidx8XORLmodifyidx1XORLmodifyidx8SETEQstoreidx1SETNEstoreidx1SETLEstoreidx1SETGEstoreidx1SETBEstoreidx1SETAEstoreidx1MOVQstoreconstMOVOstoreconstMOVBatomicloadMOVLatomicloadMOVQatomicloadMOVBELloadidx1MOVBELloadidx4MOVBELloadidx8MOVBEQloadidx1MOVBEQloadidx8ADDSshiftLLregADDSshiftRLregADDSshiftRAregSUBSshiftLLregSUBSshiftRLregSUBSshiftRAregRSBSshiftLLregRSBSshiftRLregRSBSshiftRAregADDSconstflagsFMOVSstoreidx4FMOVDstoreidx8MOVHBRstoreidxMOVWBRstoreidxMOVDBRstoreidxMOVHstoreconstMOVDstoreconstMOVDatomicloadLoweredConvertF32ConvertI64SF32ConvertI64UF64ConvertI64SF64ConvertI64UConstInterfaceCvtBoolToUint8Add32withcarrySub32withcarryAtomicOr8valueearly deadcodedecompose userdead auto elimeliminated phi%s.block != %sbad array sizeallow-x-scrollafter %s = %s
SUM_LINE_RANGEbad BoundsKindduplicate node	labelloc="t"
unsat %s %s %sunknown branchSCOND_XOR = 14%v: bad rrr %d%v: bad bra %vAMEVCNTR00_EL0AMEVCNTR01_EL0AMEVCNTR02_EL0AMEVCNTR03_EL0AMEVCNTR04_EL0AMEVCNTR05_EL0AMEVCNTR06_EL0AMEVCNTR07_EL0AMEVCNTR08_EL0AMEVCNTR09_EL0AMEVCNTR10_EL0AMEVCNTR11_EL0AMEVCNTR12_EL0AMEVCNTR13_EL0AMEVCNTR14_EL0AMEVCNTR15_EL0AMEVCNTR16_EL0AMEVCNTR17_EL0AMEVCNTR18_EL0AMEVCNTR19_EL0CNTPS_CVAL_EL1CNTPS_TVAL_EL1CONTEXTIDR_EL1ICC_ASGI1R_EL1ICC_HPPIR0_EL1ICC_HPPIR1_EL1ICV_HPPIR0_EL1ICV_HPPIR1_EL1PMCNTENCLR_EL0PMCNTENSET_EL0PMEVCNTR10_EL0PMEVCNTR11_EL0PMEVCNTR12_EL0PMEVCNTR13_EL0PMEVCNTR14_EL0PMEVCNTR15_EL0PMEVCNTR16_EL0PMEVCNTR17_EL0PMEVCNTR18_EL0PMEVCNTR19_EL0PMEVCNTR20_EL0PMEVCNTR21_EL0PMEVCNTR22_EL0PMEVCNTR23_EL0PMEVCNTR24_EL0PMEVCNTR25_EL0PMEVCNTR26_EL0PMEVCNTR27_EL0PMEVCNTR28_EL0PMEVCNTR29_EL0PMEVCNTR30_EL0PMEVTYPER0_EL0PMEVTYPER1_EL0PMEVTYPER2_EL0PMEVTYPER3_EL0PMEVTYPER4_EL0PMEVTYPER5_EL0PMEVTYPER6_EL0PMEVTYPER7_EL0PMEVTYPER8_EL0PMEVTYPER9_EL0PMINTENCLR_EL1PMINTENSET_EL1PMXEVTYPER_EL0%v: bad irr %v%v: bad imm %vbranch too far%v: bad brr %v%v: bad op0 %vuserArenaStateGC (dedicated)read mem statsasynctimerchangcstoptheworldprofstackdepthtraceallocfreeGC assist waitfinalizer waitsync.Cond.WaitSIGABRT: aborts.allocCount= runtime: mmap(nil elem type! to finalizer GC worker initruntime: full=runtime: want=MB; allocated bad restart PC, called from
-thread limit
stopm spinning nmidlelocked= needspinning=randinit twicestore64 failedsemaRoot queuebad allocCountbad span state untyped args stack overflow out of range no module data in goroutine runtime: seq1=runtime: goid= on zero Valueunknown methodgcBgMarkWorkerno old PosBaseunexpected EOFinvalid syntax1907348632812595367431640625no such deviceis a directorytext file busyfile too largetoo many linkslevel 3 haltedlevel 2 haltedprotocol errortoo many userswindow changed: extra text: iidx underflowindirect call:	unsafe-point
	unsafe-block
mapaccess2_fattypedslicecopywalkExpr ORECVconcatstring%descapeForHash[.typeAssert.%dmapaccess1_fatorder.stmt: %v%v not a Float%v not numericdeferrangefuncfloat64toint64int64tofloat64int64tofloat32argument to %vkey of map putcallee operandappendee slicecall parameterdot of pointerslice-to-arrayloop-modified-mode must be 0file not found [go.dev/e/%s]go:wasmimport go:wasmexport sourceLocationhasDynamicInitmemhash_varlengenhash %v %v
go:plugin.tabs# NextGC = %d
# LastGC = %d
# MaxRSS = %d
PMXVI16GER2SPPPMXVBF16GER2PPPMXVBF16GER2PNPMXVBF16GER2NPPMXVBF16GER2NNVFSLIDE1DOWNVFVRGATHEREI16VV<invalid 0x%x>unhandled typeinvalid opcodeGreaterOrEqualinternal errorF32ConvertI32SF32ConvertI32UF64ConvertI32SF64ConvertI32Uwasm_pc_f_loopgcWriteBarrierbad param typeApplyFunction;DifferentialD;DoubleLeftTee;DoubleUpArrow;LeftTeeVector;LeftVectorBar;LessFullEqual;LongLeftArrow;Longleftarrow;NotTildeEqual;NotTildeTilde;Poincareplane;PrecedesEqual;PrecedesTilde;RightArrowBar;RightTeeArrow;RightTriangle;RightUpVector;SucceedsEqual;SucceedsTilde;SupersetEqual;UpEquilibrium;VerticalTilde;VeryThinSpace;bigtriangleup;blacktriangle;divideontimes;fallingdotseq;hookleftarrow;leftarrowtail;leftharpoonup;longleftarrow;looparrowleft;measuredangle;ntriangleleft;shortparallel;smallsetminus;triangleright;upharpoonleft;NotEqualTilde;varsubsetneqq;varsupsetneqq;unreachable:  \.+*?()|[]{}^$runtime.rand32type:complex64
... omitting 
	localDepth: 
	growthLeft: crypto/fips140mime/multipart<endpropsdump>*** call: %+v
<endcallsites>syntax error: interface typeparameter listimperfect hashunknown escapemultiplicationargument to %stype parameterbinary literalstruct literalnil underlyingempty type setmissing returnmust be callednil constraintpredeclared %sInstEmptyWidthcountertrace=1openMapped: %v
before walk %vdwarfbasentries<autogenerated>Unhandled op %vStoreReluintptrTrailingZeros64TrailingZeros32TrailingZeros16bitsetLowestSetcgoCheckMemmovegcWriteBarrier1gcWriteBarrier2gcWriteBarrier3gcWriteBarrier4gcWriteBarrier5gcWriteBarrier6gcWriteBarrier7gcWriteBarrier8interfaceSwitchpanicnildottypearm64HasATOMICSgoPanicSlice3BUgoPanicSlice3CUpanicSliceAlenUpanicSliceAcapUpanicSlice3AlenpanicSlice3Acapstack-allocatedwasm: bad stacknegative offsetXDG_CONFIG_HOMEnot a directorycopy_file_rangeAESKEYGENASSISTVBROADCASTF32X2VBROADCASTF32X4VBROADCASTF32X8VBROADCASTF64X2VBROADCASTF64X4VBROADCASTI32X2VBROADCASTI32X4VBROADCASTI32X8VBROADCASTI64X2VBROADCASTI64X4VPBROADCASTMB2QVPBROADCASTMW2Dbranch to ATEXT%%!%c(*Node=%p)%+v-ClosureVarsNewGoDeferStmt %%!%c(*Type=%p)untyped complexbad tuple indextype:.namedata.unknown goos %sADDLconstmodifyANDLconstmodifyXORLconstmodifyLoweredNilCheckADDQconstmodifySUBQconstborrowANDQconstmodifyXORQconstmodifyBTSQconstmodifyBTRQconstmodifyBTCQconstmodifyAddTupleFirst32AddTupleFirst64MOVBEWstoreidx1MOVBEWstoreidx2MOVBELstoreidx1MOVBELstoreidx4MOVBELstoreidx8MOVBEQstoreidx1MOVBEQstoreidx8PSHUFBbroadcastMOVWloadshiftLLMOVWloadshiftRLMOVWloadshiftRALoweredRound32FLoweredRound64FNotGreaterThanFLoweredAtomicOrLoweredQuadZeroLoweredQuadMoveLoweredMuluhiloLoweredMuluoverMOVBZatomicloadMOVWZatomicloadMOVBatomicstoreMOVWatomicstoreMOVDatomicstoreLoweredTailCallI64TruncSatF64SI64TruncSatF64UI64TruncSatF32SI64TruncSatF32UIsSliceInBoundsAtomicLoadAcq32AtomicLoadAcq64AtomicExchange8AtomicAnd8valueAtomicOr64valueAtomicOr32valueisSliceInBounds [pad %d bytes]before %s = %s
bad int size %dsources of v%d:non-zero rotateruntime.memmoveslot_not_needed%s has nil Aux
AMCNTENCLR0_EL0AMCNTENCLR1_EL0AMCNTENSET0_EL0AMCNTENSET1_EL0AMEVCNTR010_EL0AMEVCNTR011_EL0AMEVCNTR012_EL0AMEVCNTR013_EL0AMEVCNTR014_EL0AMEVCNTR015_EL0AMEVCNTR110_EL0AMEVCNTR111_EL0AMEVCNTR112_EL0AMEVCNTR113_EL0AMEVCNTR114_EL0AMEVCNTR115_EL0AMEVTYPER00_EL0AMEVTYPER01_EL0AMEVTYPER02_EL0AMEVTYPER03_EL0AMEVTYPER04_EL0AMEVTYPER05_EL0AMEVTYPER06_EL0AMEVTYPER07_EL0AMEVTYPER08_EL0AMEVTYPER09_EL0AMEVTYPER10_EL0AMEVTYPER11_EL0AMEVTYPER12_EL0AMEVTYPER13_EL0AMEVTYPER14_EL0AMEVTYPER15_EL0AMEVTYPER16_EL0AMEVTYPER17_EL0AMEVTYPER18_EL0AMEVTYPER19_EL0DBGCLAIMCLR_EL1DBGCLAIMSET_EL1ICC_IGRPEN0_EL1ICC_IGRPEN1_EL1ICV_IGRPEN0_EL1ICV_IGRPEN1_EL1ID_AA64AFR0_EL1ID_AA64AFR1_EL1ID_AA64DFR0_EL1ID_AA64DFR1_EL1ID_AA64PFR0_EL1ID_AA64PFR1_EL1ID_AA64ZFR0_EL1PMEVTYPER10_EL0PMEVTYPER11_EL0PMEVTYPER12_EL0PMEVTYPER13_EL0PMEVTYPER14_EL0PMEVTYPER15_EL0PMEVTYPER16_EL0PMEVTYPER17_EL0PMEVTYPER18_EL0PMEVTYPER19_EL0PMEVTYPER20_EL0PMEVTYPER21_EL0PMEVTYPER22_EL0PMEVTYPER23_EL0PMEVTYPER24_EL0PMEVTYPER25_EL0PMEVTYPER26_EL0PMEVTYPER27_EL0PMEVTYPER28_EL0PMEVTYPER29_EL0PMEVTYPER30_EL0bad opcode: %v
bad opldr %v
%vSpecialOperand(allocmRInternalGC (fractional)write heap dumpasyncpreemptoffforce gc (idle)sync.Mutex.Lockruntime.Goschedmalloc deadlockruntime error: scan missed a gmisaligned maskruntime: min = runtime: inUse=runtime: max = requested skip=bad panic stackrecovery failedmorestack on g0stopm holding pstartm: m has ppreempt SPWRITEmissing mcache?ms: gomaxprocs=randinit missedruntime: frame traceback stuck]
	morebuf={pc:: no frame (sp=ts set in timerunexpected kindinvalid argSize<invalid Value>internal/goarch476837158203125no such processadvertise errornetwork is downno medium foundkey has expiredbad system call: cannot parse ,M3.2.0,M11.1.0initplan maplitanylit: not ptranylit: not mapgenAsStatic %+v.gostring.%d.%safter walk expr%v has pointers%v not a Stringpanicrangestatefloat64touint64float64touint32uint64tofloat64uint64tofloat32uint32tofloat64method receiverreturn argumentmissing pkgpathbad range startmap literal keycall to recoverunused auto: %vsubdictionaries.asanModulenamesizeWithRedzonememequal_varlengroupSlotOffsetincomplete itab# Lookups = %d
# Mallocs = %d
# HeapSys = %d
# PauseNs = %d
# DebugGC = %v
/proc/self/mapsunknown type %dLessOrUnordered | #I=%d, #F=%dI32TruncSatF32SI32TruncSatF32UI32TruncSatF64SI32TruncSatF64Uwasm_export_runruntime.wasmDivbad result typeDiacriticalDot;DoubleRightTee;DownLeftVector;GreaterGreater;HorizontalLine;InvisibleComma;InvisibleTimes;LeftDownVector;LeftRightArrow;Leftrightarrow;LessSlantEqual;LongRightArrow;Longrightarrow;LowerLeftArrow;NestedLessLess;NotGreaterLess;NotLessGreater;NotSubsetEqual;NotVerticalBar;OpenCurlyQuote;ReverseElement;RightTeeVector;RightVectorBar;ShortDownArrow;ShortLeftArrow;SquareSuperset;TildeFullEqual;UpperLeftArrow;ZeroWidthSpace;curvearrowleft;doublebarwedge;downdownarrows;hookrightarrow;leftleftarrows;leftrightarrow;leftthreetimes;longrightarrow;looparrowright;nshortparallel;ntriangleright;rightarrowtail;rightharpoonup;trianglelefteq;upharpoonright;BelowExactAboveHanifi_RohingyaPsalter_Pahlaviruntime.gopanicruntime.printnlruntime.printspruntime.convT16runtime.convT32runtime.convT64runtime.ifaceeqruntime.efaceeqruntime.makemapruntime.chanlenruntime.chancapruntime.memhashruntime.f32hashruntime.f64hashruntime.c64hashruntime.strhashruntime.newproctype:*complex64type:complex128table{
	index: jstmpllitinterptarinsecurepathx509keypairleafx509usepolicieszipinsecurepathFuncPropBits(0x%s:%v: %s +0x%vinvalid operandresult variable%s is too large== initFiles ==== initOrder ==%s overflows %s%s refers to %stype parameters (no core type)unexpected typewriteObject(%T)package %s (%q)/* implicit */ %s used as typeregister %s %p
not enough data-coveragecfg: %v0123456789abcdefassertion failedruntime/coveragepgo-load-profilePrefetchStreamedctrlGroupMatchH2cgoCheckPtrWriteloong64HasLAMCASloong64HasLAM_BHgoPanicSliceAlengoPanicSliceAcappanicSlice3AlenUpanicSlice3AcapUpanicExtendIndexunexpected blockVAESKEYGENASSISTloop too far: %vruntime.duffzeroruntime.duffcopyruntime.sehtrampunsafe.SliceDataif %v; %v { %v }make(%v, %v, %v)invalid Decl op unsignedType(%v)relocation: %#v
bad funcdata: %vgeneric deadcodelowered deadcodeMOVWstoreshiftLLMOVWstoreshiftRLMOVWstoreshiftRAMOVBstorezeroidxMOVHstorezeroidxMOVWstorezeroidxMOVDstorezeroidxNotGreaterEqualFGreaterEqualNoovLoweredAtomicOr8MOVVstorezeroidxLoweredAtomicAddLoweredAtomicCasLoweredAtomicAndLoweredZeroShortLoweredMoveShortLoweredInterCallAtomicStoreRel32AtomicStoreRel64AtomicExchange32AtomicExchange64AtomicAnd64valueAtomicAnd32valuepre-opt deadcodeaddressing modes  pass %s begin
%s_%02d__%s.dumplocation lists:
MemoryArg on Phi<td id="%v-exp">id="g_graph_%s";n+1st bit is setbad sizes %d %d
digraph poset {
empty undo stackunknown relation  processing %s
post shuffle %s
runtime.memequalself_interferingstacklive %s %v
SCOND = (1<<4)-1bad shift in LDR.U on neg offsetAMEVTYPER010_EL0AMEVTYPER011_EL0AMEVTYPER012_EL0AMEVTYPER013_EL0AMEVTYPER014_EL0AMEVTYPER015_EL0AMEVTYPER110_EL0AMEVTYPER111_EL0AMEVTYPER112_EL0AMEVTYPER113_EL0AMEVTYPER114_EL0AMEVTYPER115_EL0ID_AA64ISAR0_EL1ID_AA64ISAR1_EL1ID_AA64MMFR0_EL1ID_AA64MMFR1_EL1ID_AA64MMFR2_EL1bad class: %v
%vbad bfm alias
%villegal FCCMP
%vbad opxrrr %v
%vbad opload %v
%vbad opldrr %v
%vbad opstrr %v
%v%v misuses oaddiinteger overflowgcshrinkstackofftracefpunwindoffGC scavenge waitGC worker (idle)page trace flushSIGNONE: no trap__vdso_getrandom/gc/gogc:percent, not a functiongc: unswept span KiB work (bg),  mheap.sweepgen=runtime: nelems=workbuf is emptybad summary datamSpanList.removemSpanList.insertbad special kindruntime: addr = runtime: base = runtime: head =  already; errno=
runtime stack:
invalid g statusGOTRACEBACK=nonecastogscanstatusbad g transitionschedule: in cgo untyped locals missing stackmapbad symbol tablereflect mismatchnon-Go function
pointerless type not in ranges:
sigaction failedafter object keyreflect.MakeFunc: value of type internal/bytealghandleAsyncEvent%s version %s%s
invalid count %q23841857910156250123456789ABCDEFinvalid argumentinvalid exchangeobject is remotemessage too longno route to hostremote I/O errorstopped (signal)time: bad [0-9]*offset too largemapassign_fast32mapassign_fast64mapdelete_fast32mapdelete_fast64before walk expr
before order %vsmall pointer %vmissing type: %v%v is not a typeconversion to %v%L is not a type{storage for %v}assign-pair-maprno function bodycannotInlineCall%v (from inline)bad inittask: %vwant %v, have %vInitAddr n op %v                # HeapIdle = %d
# OtherSys = %d
# PauseEnd = %d
bad rr opcode %vbad ic opcode %v%+v is not a MOVunknown index %dREGTMP2 conflictEqualOrUnordered_rt0_wasm_wasip1runtime.sigpanicbad name for MOVinvalid registerbad offset in %vCloseCurlyQuote;ContourIntegral;DoubleDownArrow;DoubleLeftArrow;DownRightVector;LeftRightVector;LeftTriangleBar;LeftUpTeeVector;LeftUpVectorBar;LowerRightArrow;NotGreaterEqual;NotGreaterTilde;NotLeftTriangle;OverParenthesis;RightDownVector;ShortRightArrow;UpperRightArrow;bigtriangledown;circlearrowleft;curvearrowright;downharpoonleft;leftharpoondown;leftrightarrows;nLeftrightarrow;nleftrightarrow;ntrianglelefteq;rightleftarrows;rightsquigarrow;rightthreetimes;straightepsilon;trianglerighteq;vartriangleleft;NotHumpDownHump;NotSquareSubset;binary.BigEndianinvalid rune %#Udivision by zero+-/0123456789.eEregexp: Compile(Imperial_AramaicMeroitic_CursiveZanabazar_Squareruntime.mallocgcruntime.printintruntime.printhexruntime.mapclearruntime.makechanruntime.selectgoruntime.f32equalruntime.f64equalruntime.c64equalruntime.strequalruntime.memhash0runtime.memhash8runtime.c128hashruntime.int64divruntime.int64modruntime.racereadruntime.msanreadruntime.msanmoveruntime.asanreadtype:*complex128GODEBUG: value "exec: no commandParamPropBits(0xexpected operandinterface method%s return valuesreturn statementhave untyped nil%s used as value%s is not a type%s missing in %snil (of type %s) constrained by %s%s scope %p {
InstRuneAnyNotNLempty input filebad store type %vbad duffzero size#define %s_%s %d
%s: PGO error: %vcgo_export_staticBenchmarkCompile:bitsetRemoveBelowcheckptrAlignmentgoPanicSliceAlenUgoPanicSliceAcapUgoPanicSlice3AlengoPanicSlice3AcappanicSliceConvertpanicExtendIndexUpanicExtendSliceBpanicmakeslicelenpanicmakeslicecapunhandled stmt %vbad float size %dremoved nil checkunhandled expr %vunhandled addr %vArgInfo too large %-6s	%.5d %s	%s
needzero class %dunexpected op: %s0123456789ABCDEFX0123456789abcdefxreflect.Value.Intpidfd_send_signalVGF2P8AFFINEINVQBruntime.retpolineneed reloc for %vruntime.panicwrapruntime.morestackunsafe.StringData%s (%d entries) {blank method nameFuncPCABIInternalNewDeclNameAt niltype %L too largetype %v too largetype:.importpath.decompose builtinCMPQconstloadidx8CMPQconstloadidx1CMPLconstloadidx4CMPLconstloadidx1CMPWconstloadidx2CMPWconstloadidx1CMPBconstloadidx1LoweredAtomicOr64LoweredAtomicOr32MOVHstorezeroidx2MOVWstorezeroidx4MOVDstorezeroidx8LoweredAtomicAnd8LoweredPubBarrierLoweredStaticCallSlicePtrUncheckedSpectreSliceIndexelim unread autos  pass %s end %s
pass %s not foundLiveness pass %d
	%v : empty list
<div>&nbsp;</div>MAXMIN_LINE_RANGEdependency cycle!Proved %v boundedmoving v%d to %s
end out of boundsruntime.newobjectruntime.growsliceruntime.cmpstringruntime.makeslicebefore stackallocstack_alloc_statsillegal shift: %vnil sym in tls %vDBGAUTHSTATUS_EL1odd offset: %d
%vinvalid operationbad shift $con
%vunsupported op %v%v: bad rrr %d %vbad opstore %v
%vgoroutine profileAllThreadsSyscallGC assist markingselect (no cases)sync.RWMutex.Lockwait for GC cycletrace proc statusselect (synctest)SIGINT: interruptSIGBUS: bus errorSIGCONT: continuesync.(*Cond).Wait: missing method notetsleepg on g0bad TinySizeClassruntime: pointer g already scannedmark - bad statusscanobject n == 0markBits overflowswept cached spanruntime: summary[runtime: level = , p.searchAddr = futexwakeup addr=, 0, {interval: {ns}}, nil) errno=results: got {r1=runtime/internal/thread exhaustionlocked m0 woke upentersyscallblock spinningthreads=gp.waiting != nilunknown caller pc, synctest group stack: frame={sp:runtime: nameOff runtime: typeOff runtime: textOff in string literalunknown type kind has invalid namereflect: call of reflect.Value.Capreflect.Value.Lenreflect: New(nil)internal/godebugs-internal/bytealgbad debugtab typedebug flag %v: %v1192092895507812559604644775390625invalid bit size exec format errorpermission deniedno data availablewrong medium typeInvalidSyntaxTreeTime.AppendText: corrupt zip file fractional secondbad pos, negative=-= %d: sl=%d %s
GOCLOBBERDEADHASHStaticInit failed=-= mapvar is %v
mapaccess1_fast32mapaccess1_fast64mapaccess2_fast32mapaccess2_fast64mapassign_faststrmapdelete_faststrstrings.EqualFoldmemclrHasPointersEqInterface %v %vslicerunetostringslicebytetostringstringtoslicebytestringtosliceruneorder.safeExpr %vdouble walkSelectinteger too largetypecheckargs %+vargument to panictypechecking loopappended slice...
before escape %vnon-constant sizee.curfn isn't setmoved to heap: %vleaking param: %vmap literal value     from %v (%v)canInlineFunctiongo:nowritebarriergo:registerparamsgo:uintptrescapescgo_import_staticunexpected objectgroups_lengthMask-noname-exported.writeITab(%v, %v)go:plugin.exportsruntime.gcbits.%xunhandled kind %sInitSliceBytes %vInitConst n op %vInitConst c op %vinternal/runtime/%d: %d [%d: %d] @# HeapAlloc = %d
# HeapInuse = %d
cycles/second=%v
truncated profilemalformed profilebad rrr opcode %vbad irr opcode %vbranch too far
%vunknown suffix:%xauto-SPWRITE: %s
I32ReinterpretF32I64ReinterpretF64F32ReinterpretI32F64ReinterpretI64wasm_export_getspEnd without blockbad name for Callbad type for CallDiacriticalAcute;DiacriticalGrave;DiacriticalTilde;DoubleRightArrow;DownArrowUpArrow;EmptySmallSquare;GreaterEqualLess;GreaterFullEqual;LeftAngleBracket;LeftUpDownVector;LessEqualGreater;NonBreakingSpace;NotRightTriangle;NotSupersetEqual;RightTriangleBar;RightUpTeeVector;RightUpVectorBar;UnderParenthesis;UpArrowDownArrow;circlearrowright;downharpoonright;ntrianglerighteq;rightharpoondown;rightrightarrows;twoheadleftarrow;vartriangleright;NotPrecedesEqual;NotSucceedsEqual;NotSucceedsTilde; from a write of exponent overflowFloat.GobDecode: %%!%c(big.Int=%s)Old_North_ArabianOld_South_Arabianruntime.throwinitruntime.gorecoverruntime.printboolruntime.printuintruntime.printlockruntime.intstringruntime.slicecopyruntime.assertE2Iruntime.makemap64runtime.mapassignruntime.mapdeleteruntime.chanrecv1runtime.chanrecv2runtime.chansend1runtime.closechanruntime.memequal0runtime.memequal8runtime.c128equalruntime.memhash16runtime.memhash32runtime.memhash64runtime.interhashruntime.uint64divruntime.uint64modruntime.racewriteruntime.msanwriteruntime.asanwriteruntime.x86HasFMAruntime.deferprocexec: killing Cmdexec: not startedmultipartmaxpartswinreadlinkvolumeGO PREPROFILE V1
<endfilepreamble><endfuncpreamble>marshal error %v
ResultPropBits(0xscoreAdjustTyp(0xunhandled %v (%v)composite literalexpected { after newline in stringno active segment%s must be calledin call to %s, %s=> cycle is valid%s does not %s %sinvalid statementswitch expressioncannot declare %smissing closing )missing closing ]unexpected resultregistered %s %p
metadata too longPeriodType: %s %sunexpected token index > windowEnd%v: undefined: %v
dwarflocationlistscgo_export_dynamicpublicationBarrierctrlGroupMatchFull
	%v: called by %vgoPanicSlice3AlenUgoPanicSlice3AcapUpanicExtendSliceBUpanicExtendSlice3BpanicExtendSlice3Cgenerating SSA forbefore insert phisbad AddAux addr %vreflect.Value.Uintruntime.panicshiftruntime.panicIndexruntime.panicSliceruntime.morestackc%v already has DclNewClosureVar: %+vbad package prefixempty package path$i128.%016x%016x%sshould not be hereORLconstmodifyidx4MOVBstoreconstidx1MOVWstoreconstidx1MOVWstoreconstidx2MOVLstoreconstidx1MOVLstoreconstidx4LoweredGetCallerPCLoweredGetCallerSPORQconstmodifyidx1ORQconstmodifyidx8ORLconstmodifyidx1ORLconstmodifyidx8MOVQstoreconstidx1MOVQstoreconstidx8LoweredAtomicAnd64LoweredAtomicAnd32LoweredAtomicAdd64LoweredAtomicAdd32LoweredAtomicCas64LoweredAtomicCas32LoweredAtomicLoad8LoweredClosureCallAtomicStorePtrNoWBAtomicAdd32VariantAtomicAdd64VariantCSE.partition #%d:nth bit is not setProved %v non-zerobad register state  SPILL %s->%s %s
 [lsb=%d,width=%d]null sym external
%v: unknown asm %drequires uimm16
%villegal offset: %vinvalid offset: %vinvalid offset %v
adaptivestackstartdontfreezetheworldtraceadvanceperiodtracebackancestorsgarbage collectionsync.RWMutex.RLockGC worker (active)stopping the worldwait until GC endsbad lfnode addresssystem page size (  but memory size /gc/pauses:seconds because dotdotdotruntime: npages = invalid skip valueruntime: range = {runtime: released=index out of rangeruntime:   gp: gp=runtime: getg:  g=forEachP: not done in async preempt
instruction bytes:mp.gsignal stack [bad manualFreeListruntime: textAddr  frames elided...
, locked to threadTEST_TELEMETRY_DIRexceeded max depthinvalid character in numeric literalvalue out of rangeflag %q contains =flag redefined: %sreflect.Value.Callreflect.Value.Elemreflect.Value.Sendreflect.Value.Typereflect: Zero(nil)internal/byteordersystemstack_switch298023223876953125input/output errorno child processesfile name too longno locks availableidentifier removedmultihop attemptedRFS specific errorstreams pipe errorconnection refusedoperation canceledsegmentation fault: day out of rangeTime.MarshalJSON: Time.MarshalText: unknown time zone pos not decreasing=-= %d L%d|C%d %s
  =-= navail = %d
=-= regions (%d): forkAndExecInChild			CLOBBERDEAD %s
stack object %v %vforcelabels=true;
initplan structlitmapaccess1_faststrmapaccess2_faststrconvas: not OAS %vlibfuzzerTraceCmp1libfuzzerTraceCmp2libfuzzerTraceCmp4libfuzzerTraceCmp8checkptrArithmeticValue.MethodByNameorder.mapAssign %vorder select ninituse of untyped nilunknown builtin %vwriting output: %vbufio: buffer full%v escapes to heap%v does not escape%v has no location%v: can inline %v
marked go:noinlineheapBits.nextArenaimporting %s (%s)
go:cgo_unsafe_argscgo_dynamic_linkercgo_import_dynamicreshaping %L to %vshaped receiver %v%v is a shape typeunhandled decl: %vinvalid method: %vexpected value: %vmissing expressionInitAddr nil n symnot a regular file# TotalAlloc = %d
# Stack = %d / %d
# MSpan = %d / %d
unknown type %d %vbad rrrr opcode %vbad rrr opcode -%vbad irr opcode -%vinvalid ops for %vbad load opcode %vunhandled type %+vregtmp(p) conflictGreaterOrUnorderedwasm_export_resumeruntime.wasmTruncSruntime.wasmTruncUbad target for JMPlabel not at blockbad type for *LoadDoubleUpDownArrow;DoubleVerticalBar;DownLeftTeeVector;DownLeftVectorBar;FilledSmallSquare;GreaterSlantEqual;LeftDoubleBracket;LeftDownTeeVector;LeftDownVectorBar;LeftTriangleEqual;NegativeThinSpace;NotReverseElement;NotTildeFullEqual;RightAngleBracket;RightUpDownVector;SquareSubsetEqual;VerticalSeparator;blacktriangledown;blacktriangleleft;leftrightharpoons;rightleftharpoons;twoheadrightarrow;NotGreaterGreater;NotLessSlantEqual;NotNestedLessLess;NotSquareSuperset;use of closed filecannot be negativenegative bit indexCaucasian_Albanianruntime.printfloatruntime.printifaceruntime.printefaceruntime.printsliceruntime.decoderuneruntime.countrunesruntime.convTnoptrruntime.convTsliceruntime.assertE2I2runtime.typeAssertruntime.mapaccess1runtime.mapaccess2runtime.makechan64runtime.memequal16runtime.memequal32runtime.memequal64runtime.interequalruntime.memhash128runtime.addCovMetax509negativeserial// %s %s %d %d %d
pgoir-devirtualizeinvalid BranchStmtexpected name or (<unknown position>bitwise complement%s is not constantargument to delete=> %s (under = %s)%s truncated to %sgeneric type alias<function literal> with invalid typeextra init expr %stype instantiationdiscards result of-- type set for %snil type parameterunexpected type %Tu.nify(%s, %s, %d)not a package filenewCounter %s: %v
invalid syntax at generated nil check/gc/heap/goal:bytesreflect.Value.IsNil%s triggered %s %s
compile/invocationsUnhandled block: %sCompareAndSwapInt32CompareAndSwapInt64ctrlGroupMatchEmptygoPanicSliceConvertpanicExtendSlice3BUpanicExtendSlice3CUpanicunsafeslicelendottype of non-loadbad integer size %dbad complex size %dbad call type %v %v %-6s	%.5d (%s)	%s
reflect.Value.Floatunexpected addr: %vunsupported SAE: %vasmins bad table %vcall without target__x86.get_pc_thunk.runtime.panicdivideunexpected type: %vNewDeclNameAt op %vinterface too largeduplicate method %sPutDefaultFunc(%v)
<unknown file name><Prog without ctxt>ADDLconstmodifyidx4ANDLconstmodifyidx4XORLconstmodifyidx4LoweredPanicBoundsALoweredPanicBoundsBLoweredPanicBoundsCLoweredPanicExtendALoweredPanicExtendBLoweredPanicExtendCADDQconstmodifyidx1ADDQconstmodifyidx8ANDQconstmodifyidx1ANDQconstmodifyidx8XORQconstmodifyidx1XORQconstmodifyidx8ADDLconstmodifyidx1ADDLconstmodifyidx8ANDLconstmodifyidx1ANDLconstmodifyidx8XORLconstmodifyidx1XORLconstmodifyidx8LoweredAtomicLoad32LoweredAtomicLoad64LoweredAtomicStore8AtomicStore8Variant%s.Func=%s, want %ssplit critical edgearray not of size 1Store of not a load...recur addArg %s
loop finding in %s
loop finding at %s
n+1st bit isn't setnon-empty noneq map	subgraph root%d {
assignReg %s %s/%s
copy %s to %s : %s
no g register foundphis in entry blockN=%v,Z=%v,C=%v,V=%vstart out of boundsReplace %v with %v
Must lower lattice
moveTo bad index %dv%d interferes with%v: missing literalmisaligned label
%vstrongFromWeakQueueGC mark terminationsync.WaitGroup.WaitSIGTRAP: trace trapwait for debug call__vdso_gettimeofdaycgocall unavailablepanicwrap: no ( in panicwrap: no ) in  called using nil *unknown wait reasonnotesleep not on g0bad sequence numberGC work not flushedunaligned sysUnused/gc/scan/heap:bytes/gc/heap/live:bytesbad kind in runfinqmarkroot: bad indexnwait > work.nprocs, gp->atomicstatus=marking free object KiB work (eager),  [controller reset]mspan.sweep: state=sysMemStat overflowruntime: heapInUse=runtime: totalFree=panic during mallocpanic holding locksmissing deferreturnunexpected gp.parampanic during panic
,  g->atomicstatus=unexpected g status_cgo_setenv missingbad runtime·mstartm not found in allmstopm holding lockssemaRoot rotateLeftbad notifyList sizeruntime: pcdata is runtime: preempt g0after array elementbad flag syntax: %sreflect.Value.Bytesreflect.Value.Fieldreflect.Value.Indexreflect.Value.Slicereflect.Value.Clear are not comparable14901161193847656257450580596923828125bad file descriptortoo many open filesdirectory not emptydevice not a streamdisk quota exceededillegal instructionstopped (tty input)bad value for field/usr/lib/locale/TZ/no entry for leadershould never happenstatic inlined-LEFTstatic inlined-ORIG=-= newfunc is %+v
mapassign_fast32ptrmapassign_fast64ptrassigning %v to %+vunsafeslicecheckptrlibfuzzerHookStrCmpfixedlit bad op: %vgenAsStatic: lhs %vgenAsStatic: rhs %vorder.stmt range %vinvalid %v call: %v.interfaceSwitch.%d%v not Int or Floatasanregisterglobalsunexpected size: %vno curfn for TempAtcannot make type %vcannot switch on %L%L has untyped typecannot assign to %vstringtoarraylit %vgo:cuinfo.producer.//go:uintptrescapestoo large for stackunexpected node: %vinterface-convertedreflect.Header.Data   flow: %s = %s%v:unexpected stmt: %vassign-pair-receivebigEndian.PutUint16bigEndian.PutUint32bigEndian.PutUint64littleEndian.Uint16littleEndian.Uint32littleEndian.Uint64%s/pkg/%s_%s%s/%s.a%s/pkg/%s_%s%s/%s.ounexpected type: %Tgo:uintptrkeepaliveexpected method: %vunresolved stub: %v%v missed typecheck-noname-unexported.map elem too big %dInitConst nil n syminvalid URL escape missing ']' in host#	%#x	%s+%#x	%s:%d
# HeapObjects = %d
# MCache = %d / %d
# BuckHashSys = %d
# NumForcedGC = %d
sampling period=%d
%v is not supportedillegal EH field
%villegal syscall: %vbad loadx opcode %v%v: unsupported MOVstuck in spanz loop%s } %s: %d typ: %vbad target for CALLDownRightTeeVector;DownRightVectorBar;LongLeftRightArrow;Longleftrightarrow;NegativeThickSpace;PrecedesSlantEqual;ReverseEquilibrium;RightDoubleBracket;RightDownTeeVector;RightDownVectorBar;RightTriangleEqual;SquareIntersection;SucceedsSlantEqual;blacktriangleright;longleftrightarrow;NotLeftTriangleBar;skip this directorybinary.LittleEndianunexpected InstFailCanadian_AboriginalKhitan_Small_Scriptruntime.printstringruntime.printunlockruntime.concatbyte2runtime.concatbyte3runtime.concatbyte4runtime.concatbyte5runtime.concatbytesruntime.convTstringruntime.mapiterinitruntime.mapiternextruntime.mapIterNextruntime.typedmemclrruntime.selectsetpcruntime.makeslice64runtime.memequal128runtime.x86HasSSE41runtime.armHasVFPv4runtime.deferreturntype:unsafe.Pointerexec: canceling Cmdgotestjsonbuildtextmultipartmaxheadersfile already existsfile does not existfile already closed%d  %d	%s	%s	%s	%s
grouped declarationmissing import pathin type declarationexpected expression... is missing typeat end of statementneed type assertioncannot assign to %s%s has core type %s%s has no core type== unusedImports ==== recordUntyped ==constant %soverflowunknown operator %s(missing method %s)anonymous parameterempty weekends fileparsing profile: %wmissing close paren/gc/heap/frees:bytes%v: too many errors
#define const_%s %v
#define %s__size %d
can't create %s: %v
no_pointers_stackmapslicebytetostringtmpinternal/runtime/sysCompareAndSwapUint32CompareAndSwapUint64bitsetShiftOutLowestpanicExtendSliceAlenpanicExtendSliceAcappanicunsafestringlen<dl class="ssa-gen">span must be loopingauto-SPWRITE: %s %v
missed typecheck: %LNode.MarkReadonly %v%%!%c(*types.Sym=%p)want %v, but have %vLoweredGetClosurePtrLoweredHasCPUFeatureLoweredAtomicStore32LoweredAtomicStore64LoweredQuadZeroShortLoweredQuadMoveShortLoweredAtomicLoadPtrAtomicStore32VariantAtomicStore64Variantvalue %s has nil argbad arg to OpAddr %vat %v: %v now in %s
self-loop on node %dno SP register foundno SB register foundde-virtualizing callruntime.racefuncexitamount out of boundsstackalloc %s to %s
op %s isn't OpConst*store op unknown: %sinvalid constant: %vinvalid condition
%vinvalid operands: %voperand mismatch: %vfloating point errorGC sweep terminationResetDebugLog (test)chan send (nil chan)flushing proc cacheschan send (synctest)SIGALRM: alarm clockSIGTERM: termination__vdso_clock_gettimeclose of nil channelinconsistent lockedmnotetsleep not on g0bad system page size to unallocated span/gc/scan/stack:bytes/gc/scan/total:bytes/gc/gomemlimit:bytesp mcache not flushed markroot jobs done
pacer: assist ratio=workbuf is not emptybad use of bucket.mpbad use of bucket.bpruntime: totalAlloc=runtime: double waitpreempt off reason: forcegc: phase errorgopark: bad g statusgo of nil func valueselectgo: bad wakeupsemaRoot rotateRightreflect.makeFuncStubtrace: out of memorywirep: already in gojson: Unmarshal(nil)json: Unmarshal(nil json: error calling flag: help requestedreflect: cannot use  returned zero Valuereflect.Value.IsZeroreflect.Value.Methodreflect.Value.SetIntreflect.Value.Slice3internal/chacha8randinternal/stringsliteinvalid headtype: %qinvalid write result37252902984619140625invalid request codebad font file formatconnection timed outis a named type filekey has been revokedstopped (tty output)urgent I/O conditiontime: invalid number/usr/share/zoneinfo/pos %d var %q unused=-= last use of v%d
%d: %v sz=%d ivs=%s
(%s) function entry
static inlined-RIGHTunexpected lvalue %vmemclrNoHeapPointersunsafestringcheckptremptyTypeAssertCacheunexpected call: %+vmissed FixMethodCallninit on select recvninit on select sendbad switch case bodytoo few values in %vmetahash bad byte %qfixed-array-index-ofunexpected addrtakenderefs underflow: %v%v:[%d] %v stmt: %v
label %v missing tagassign-pair-dot-typecannotInlineFunctionmarked go:nocheckptr%v:call to func %+v
%s cannot be inlinedrecursive call to %sgo:cgo_export_staticgo:cgo_import_staticcannot import "main"import path is emptyconf.Check error: %vgo:nowritebarrierrecunexpected statementunhandled expressionunexpected class: %vmissed typecheck: %vsrc is %v, dst is %vPutAbstractFunc(%v)
PutConcreteFunc(%v)
malformed ELF binary
# runtime.MemStats
# HeapReleased = %d
unhandled opcode.
%v%v: unknown rotationunexpected opcode %vcannot use index regunknown rr opcode %v_rt0_wasm_wasip1_libinvalid results typeDoubleLongLeftArrow;DownLeftRightVector;LeftArrowRightArrow;NegativeMediumSpace;RightArrowLeftArrow;SquareSupersetEqual;leftrightsquigarrow;NotGreaterFullEqual;NotRightTriangleBar;number has no digits%%!%c(*big.Float=%s)Egyptian_HieroglyphsMeroitic_Hieroglyphsruntime.goPanicIndexruntime.printcomplexruntime.printpointerruntime.printuintptrruntime.mapIterStartruntime.writeBarrierruntime.typedmemmoveruntime.selectnbsendruntime.selectnbrecvruntime.nilinterhashruntime.x86HasPOPCNTtype:*unsafe.Pointerhttplaxcontentlengthx509usefallbackrootsshould never executesomething went wrongFuncPropNeverReturnslabel %s not definedsemicolon or newlinenegative indentationmap index expressioncomma, ok expressionconstant declaration%s.%s undefined (%s)== collectObjects ==== packageObjects ==== processDelayed ==variable declarationinvalid use of '...'missing index for %s%s does not %s %s %sinstantiation cycle: with empty type setis not an expressionbranch statement: %scannot range over %sexpected string typegzip: invalid headerexpression too largeinvalid repeat countCounter.Add negativeregister %s next %p
making local dir: %vnewCounter %s in %s
place %s at %#x-%#x
pkg/tool/linux_amd64flate: closed writersha3: Sum after ReadInvalid rounding modeinput[1] not in AX %s/gc/heap/allocs:bytesinternal/runtime/mapsexternal %v nil type
NOT/NOTW generated %sSumBytes generated %sinternal/runtime/mathCompareAndSwapUintptrnot a merge candidateroot already in queueNewPtr: elem mismatchpanicExtendSliceAlenUpanicExtendSliceAcapUpanicExtendSlice3AlenpanicExtendSlice3Acapunhandled OLITERAL %vbad type for index %vbad type in slice %v
<dd class="ssa-prog">wasm: bad LoweredAddrreflect.Value.Complexasmins: missing op %v_GLOBAL_OFFSET_TABLE_%v cannot represent 1ConstOverflow: %v, %vsliceheader{%v,%v,%v}RefersTo bad Name: %vmissing typecheck: %vearly CalcSize stringCalcSize fn struct %vUnknownAttribute(%d)|wrote %d bytes to %p
runtime.addmoduledatainsert resched checksLoweredAtomicExchangeLoweredAtomicAddconstAtomicOr8valueVariantPrefetchCacheStreamedno args for OpAddr %sTIME(ns):BYTES:ALLOCS...marking %v unused
Nonloop blocks in %s:invalid predecessors
converted OpPhi to %vsetnoneq on same node	labeldistance="3.0"
invalid newnode indexuse distances for %s
src %s: v%d cache=%s
%s: rewriting for %s
rewriting %s  ->  %s
runtime.racefuncenterinvalid .S suffix: %vinvalid .P suffix: %vinvalid .W suffix: %vinvalid .U suffix: %vsym->size=%d, invalidillegal mb option:
%vinvalid condition: %villegal bit number
%voperand mismatch: %v
illegal argument: %v
omovlit add %d (%#x)
negative shift amountdataindependenttimingsystem goroutine waitconcurrent map writesruntime: work.nwait=  previous allocCount=, levelBits[level] = runtime: searchIdx = runtime: mappedReady=runtime: totalMapped=defer on system stackpanic on system stackasync stack too large_cgo_unsetenv missingstartm: m is spinningstartlockedm: m has pfindrunnable: wrong ppreempt at unknown pcreleasep: invalid argcheckdead: runnable gruntime: newstack at runtime: newstack sp=runtime: confused by  pcHeader.textStart= timer data corruptiondue to a non-default after top-level valuein string escape codeflag %q begins with -%s flag redefined: %sunknown ABI part kind of unexported methodunexpected value stepreflect.Value.SetZeroreflect.Value.Pointerreflect.Value.SetUintinternal/goexperimentbadly formatted inputunknown debug key %s
<unknown line number>186264514923095703125931322574615478515625block device requiredread-only file systempackage not installedlink has been severedstale NFS file handlestate not recoverabletrace/breakpoint trapuser defined signal 1user defined signal 2virtual timer expiredtime zone offset hour=-= overlapping %+v:
=-= b%d instr %d: %s
brcom: no com for %v
brrev: no rev for %v
fixedlit: bad kind %dmissed typecheck: %+v(*rtype).MethodByNametoo many values in %vambiguous selector %v: need type assertioncannot use _ as valueinvalid assign op: %vseeking in output: %vbufio: negative countunexpected Class: %+v  %d: II:%d (%s) V: (too aligned for stackcaptured by a closurearray literal elementslice-literal-elementbad declaration of %v%v: %v looping label
go:cgo_export_dynamicgo:cgo_import_dynamicgo:cgo_dynamic_linkergo:yeswritebarrierrecmissing function bodywant %v type, have %vbad group size for %vbad pointer base typelen != cap (%d != %d)%s profile: total %d
# GCCPUFraction = %v
bad i/r/r/r opcode %vbad i/i/r/r opcode %v%v overflows an int32%v overflows a uint32unknown rre opcode %vunknown ril opcode %vwasm_pc_f_loop_exportbad Get: invalid nameCapitalDifferentialD;DoubleLeftRightArrow;DoubleLongRightArrow;EmptyVerySmallSquare;NestedGreaterGreater;NotDoubleVerticalBar;NotLeftTriangleEqual;NotSquareSubsetEqual;OpenCurlyDoubleQuote;ReverseUpEquilibrium;NotGreaterSlantEqual;unsupported operationbad type in compare: Float.SetFloat64(NaN)set bit is not 0 or 1Anatolian_HieroglyphsInscriptional_Pahlaviruntime.goPanicIndexUruntime.goPanicSliceBruntime.concatstring2runtime.concatstring3runtime.concatstring4runtime.concatstring5runtime.concatstringsruntime.panicdottypeEruntime.panicdottypeIruntime.makemap_smallruntime.makeslicecopyruntime.nilinterequalruntime.complex128divruntime.racereadrangeruntime.loong64HasLSXruntime.panicoverflowexec: already startedActualExprPropBits(0xinvalid line number: invalid NUL characterinvalid character %#Ustring not terminatedargument to built-in ERROR: %s (code = %d)invalid syntax tree: no key:value expectedlabel %s not declared%s instantiated as %s%s cannot be comparedextra init expr at %srecursive lazy objectmore tags than fieldsinterface{comparable}cycle start not foundinvalid named capturecounter name too longmalformed profile: %vunknown wire type: %dbad DUFFCOPY AuxInt %vshift out of range: %dprint version and exitinvalid FIDBR mask: %vruntime_LoadAcquintptrpanicExtendSlice3AlenUpanicExtendSlice3AcapUpanicunsafeslicenilptrcannot inline cap(map)type assertion inlinedoffset too large in %sasmand: bad address %vasmins: illegal 64: %vcannot SetTypecheck %d%v: not a variable: %v%v out of range for %vnegative pc offset: %vLoweredAtomicExchange8LoweredAtomicOr32valueLoweredAtomicOr64valueLoweredAtomicStorezeroAtomicCompareAndSwap32AtomicCompareAndSwap64AtomicExchange8VariantAtomicOr64valueVariantAtomicOr32valueVariantAtomicAnd8valueVariant%s -> %s [color="%s"];changeroot on non-rootremoveroot on non-rootspurious value [%d]=%d	edge [ fontsize=10 ]
rewrite cycle detected%s needs a stack slot
internal inconsistencypc invalid: %v size=%dinvalid register in %v%v: wrong width or LSBMOV to shifter operandnon-zero offset in ABXinvalid ldp source: %vshift out of range: %vinteger divide by zeroCountPagesInUse (test)ReadMetricsSlow (test)trace reader (blocked)trace goroutine statusGC weak to strong waitSIGSTKFLT: stack faultSIGTSTP: keyboard stopsend on closed channelcall not at safe pointgetenv before env initinterface conversion: s.freeindex > s.nelemsbad sweepgen in refillspan has no free spacefreeIndex is not validruntime: out of memory/gc/scan/globals:bytes/gc/heap/frees:objectsruntime: work.nwait = runtime:scanstack: gp=scanstack - bad statusheadTailIndex overflowruntime: heapReleased=runtime: global value=runtime.main not on m0set_crosscall2 missingbad g->status in readywirep: invalid p stateassembly checks failed received during fork
stack not a power of 2minpc or maxpc invalidnon-Go function at pc=build line missing '=' into Go struct field json: unknown field %qreflect.Value.MapIndexreflect.MapIter.SetKeyunexpected method stepreflect.Value.SetFloat to array with length internal/profilerecordinvalid debug value %v4656612873077392578125argument list too longcannot allocate memoryremote address changedprotocol not availableprotocol not supportedaddress already in usenetwork is unreachable/lib/time/zoneinfo.zip=-= SymAddr(%s) on %s
libfuzzerHookEqualFoldmissing typecheck: %+v%v has EscNone, but %vmissing wrapper for %vmissed FixVariadicCallexpected OITAB, got %vinvalid shift %v %s %dunexpected op: %v (%v)invalid indirect of %Largument to unsafe.Addunexpected untyped nilunexpected call op: %vcannot assign %v to %vcall pointer method ongo:cuinfo.packagename.DwarfAbstractFunc(%v)
unknown scope positionunexpected expr: %s %vstruct literal elementCanInline no nname %+vbigEndian.AppendUint16bigEndian.AppendUint32bigEndian.AppendUint64littleEndian.PutUint16littleEndian.PutUint32littleEndian.PutUint64go:cgo_import_dynamic unexpected %s: %v (%T)%v is a type parameterhashfor with AMEM typewant %v or %v, have %vtag too long: %d %s...putscope(%v,%d): vars:expected func name: %vunexpected encoding
%vruntime.notInitializedCloseCurlyDoubleQuote;DoubleContourIntegral;FilledVerySmallSquare;NegativeVeryThinSpace;NotPrecedesSlantEqual;NotRightTriangleEqual;NotSucceedsSlantEqual;reflectlite.Value.TypeInt.Scan: invalid verbinvalid number base %dRat.Scan: invalid verbInscriptional_ParthianNyiakeng_Puachue_Hmongruntime.goschedguardedruntime.goPanicSliceBUruntime.goPanicSlice3Bruntime.goPanicSlice3Cruntime.deferrangefuncruntime.mapaccess1_fatruntime.mapaccess2_fatruntime.typedslicecopyruntime.float64toint64runtime.int64tofloat64runtime.int64tofloat32runtime.racewriterangeruntime.deferprocStackruntime.gcWriteBarrierexit hook invoked exitinvalid break label %smethod has no receiverexpected comma, : or ]missing parameter typemissing parameter namecannot use %s as valueinvalid UTF-8 encodingexponent has no digitscomment not terminatedfunction instantiationinvalid package name _%s is not an interface%s does not %s %s (%s)malformed constant: %sinvalid recursive typearray or slice literal(unexported method %s)unnamed type parameterunhandled type tag: %vgzip: invalid checksumerror parsing regexp: invalidate %s: no ptr
not a build constraintunexpected length codesimulated CAST failuresha3: Write after Readdevirtualize-and-inline%d uncompiled functionsinternal/runtime/atomicruntime_StoreReluintptr%v has unexpected Op %v=-= sorted DCL for %v:
arch %s not implementedexpected array type: %vpanicunsafestringnilptrappend: len-only updatebad sized float type %vcannot inline len(chan)cannot inline cap(chan)op must be OLEN or OCAPunknown Syslook func %v<invalid reflect.Value>unknown GOEXPERIMENT %sunsupported zeroing: %vasmins: unknown z %d %vinvalid load of TLS: %vunaligned stack size %d%s: unbalanced PUSH/POP%v not marked addrtakenOXDOT in OuterValue: %vno package path in nameclosureName: bad Op: %vABI0ABIInternalABICountcrypto/internal/fips140dwarfSym of non-TEXT %v-json version must be 0tighten tuple selectorsLoweredAtomicExchange64LoweredAtomicExchange32LoweredAtomicOr8VariantLoweredAtomicAnd32valueLoweredAtomicAnd64valueLoweredAtomicAddconst32LoweredAtomicAddconst64AtomicExchange32VariantAtomicExchange64VariantAtomicAnd64valueVariantAtomicAnd32valueVariantunknown aux type for %svalue %s appears twice!deadcode after regallocBlock %v done, locs:
%vunexpected pointer size%v undecomposed type %v...storeArg %s, %v, %d
Redirect %s based on %s<span class="depcycle">range is not valid: %v
 (agrees with previous)addU overflowed %d + %dafter b=%s, rewrite=%s
non-empty value map: %vnon-empty root list: %vnon-empty undo list: %vsm,SM,um,UM=%d,%d,%d,%dboolean not constant %vInverted loop iterationunexpected integer size  %s: orig:%s cache:%s
delete copied value %s
moveTo after schedulingunaligned pointer write!pc invalid: %v size=%dunknown op in build: %villegal combination: %vsave suppressed in: %s
illegal SP reference
%vinvalid arrangement: %villegal bit position
%villegal SYS argument
%vinvalid ldp source: %v
invalid instruction %v
index out of range [%x]ReadMemStatsSlow (test)runtimecontentionstackschan receive (nil chan)garbage collection scanchan receive (synctest)SIGIO: i/o now possibleSIGSYS: bad system callmakechan: bad alignmentclose of closed channelunlock of unlocked lock) must be a power of 2
system huge page size (runtime: s.allocCount= s.allocCount > s.nelems/gc/heap/allocs:objectsmissing type in runfinqruntime: internal errorwork.nwait > work.nprocleft over markroot jobsgcDrain phase incorrectMB during sweep; swept bad profile stack countruntime: eventfd failedruntime: netpoll failedpanic during preemptoffnanotime returning zeroschedule: holding locksprocresize: invalid argmisuse of profBuf.writeunexpected signal valuespan has no free stacksstack growth after forkshrinkstack at bad timereflect.methodValueCallunexpected trace readerjson: cannot unmarshal  into Go value of type unexpected map key typereflect.Value.Interfacereflect.Value.NumMethodinternal/coverage/rtcovbytes.Buffer: too largepattern bits too long: 23283064365386962890625operation not permittedinterrupted system calldevice or resource busyno space left on deviceoperation not supportedCPU time limit exceededprofiling timer expiredtime zone offset minutetime zone offset second=-= committed for: %+v
libfuzzerTraceConstCmp1libfuzzerTraceConstCmp2libfuzzerTraceConstCmp4libfuzzerTraceConstCmp8(*interfaceType).Methodunknown op in select %vifaceData interface: %v%v is not a valid tokennon-integer %s index %vmissing argument to newreturn outside functiongraph inconsistency: %vnote: missing where/why
found %v, written at:
type param method exprspackage never finalizedmissing Types entry: %vpackage mismatch for %vname too long: %d %s...missing protocol schemeinvalid URI for requestshort branch too far
%vBH must be 0,1,3 for %vunknown store opcode %vunhandled operation: %vruntime.gcWriteBarrier1runtime.gcWriteBarrier2runtime.gcWriteBarrier3runtime.gcWriteBarrier4runtime.gcWriteBarrier5runtime.gcWriteBarrier6runtime.gcWriteBarrier7runtime.gcWriteBarrier8DiacriticalDoubleAcute;NotSquareSupersetEqual;runtime.goPanicSlice3BUruntime.goPanicSlice3CUruntime.panicnildottyperuntime.interfaceSwitchruntime.panicrangestateruntime.float64touint64runtime.float64touint32runtime.uint64tofloat64runtime.uint64tofloat32runtime.uint32tofloat64runtime.arm64HasATOMICStype:func(error) string", missing CPU support
exec: Stdin already setexit hook invoked panicdevirtualizing %v to %vinvalid column number: expected ~ term or typemissing type constraintnewline in rune literalcomma, error expressionnon-terminated alias %s%s is not an expressionother declaration of %s%s requires %s or laterbranch statement: %s %snil (with invalid type)inner declaration of %sinvalid array length %sinvalid escape sequenceunknown empty width argAdd %q += %d: count=%d
releaseLock %s: ptr=%v
flate: internal error: %v: undefined: %v in %v
enqueueFunc %v inside %vgo.internal/runtime/mapswrite barrier prohibitedvariable is not subsumedunhandled OCONV %s -> %sexpected ABIInternal: %vunsupported rounding: %vimpossible byte registerruntime.morestack_noctxtunexpected node: %v (%v)width not calculated: %vinvalid alignment for %vbad type for map key: %vcrypto/internal/fips140/	rel %d+%d t=%v %s%s+%x
	rel %d+%d t=%v %s%s+%d
%s: symbol %s redeclaredCannot repeat -json flagLoweredAtomicAnd8VariantLoweredAtomicOr64VariantLoweredAtomicOr32VariantLoweredAtomicStorezero32LoweredAtomicStorezero64lowered deadcode for cse    piece %d -> dwreg %drewriteCallArgs(%s; %d)
...recur store %s at %s
dumped SSA for %s to %v
couldn't find dot sep %qsubU underflowed %d - %dbefore b=%s, rewrite=%s
non-empty nodes list: %vnew limit %s %s unsat=%vProved %v shifts to zerofreeReg %s (dump %s/%s)
  processing control %s
live at end, no uses v%dinvalid struct store: %vRewire %v %v successors
unknown second op for %v%v: missing or wrong LSBinvalid .P/.W suffix: %vimplausible condition
%vinvalid arrangement: %v
tracecheckstackownershiphash of unhashable type cannot open standard fdsspan has no free objectsruntime: found obj at *(/cgo/go-to-c-calls:calls/gc/heap/objects:objects/sched/latencies:secondsqueuefinalizer during GCupdate during transitionruntime: markroot index can't scan our own stackgcDrainN phase incorrectpageAlloc: out of memoryruntime: p.searchAddr = range partially overlapsruntime: epollctl failedstack trace unavailable
runqsteal: runq overflowruntime: mp.lockedInt = unexpected syncgroup setdouble traceGCSweepStartbad use of trace.seqlockjson: unsupported type: reflect.MapIter.SetValuereflect.StructOf: field reflect.Value.SetComplexreflect.Value.UnsafeAddrinternal/runtime/syscallinvalid pattern syntax: 116415321826934814453125582076609134674072265625function not implementedlevel 2 not synchronizedlink number out of rangeout of streams resourcesconnection reset by peerstructure needs cleaningfloating point exceptionfile size limit exceededRawSockaddrAny too small/usr/share/lib/zoneinfo/invalid argument to Intnwant OINDEXMAP, have %+vanylit: not struct/array%v with unexpected ninitmkcall with nil init: %vcannot use %L as type %vmissing argument to make%L is not pointer shaped%v declared but not usedunexpected arguments: %vambiguous selector %v.%vtype %v has no method %vinvalid use of ... in %vtoo many arguments to %vteeHole: negative derefs%s: %v escapes to heap:
invalid derefs count: %v%v:%v non-looping label
%v: inlining call to %v
%v: After inlining %+v

local imports disallowedimport path contains NUL!"#$%&'()*,:;<=>?[]^`{|}missing reader for %q.%vimprecise interface callexpected dictParam in %vunexpected type: %v (%T)unexpected core type: %vwant slice type, have %vkey align too big for %vmethod with no sym on %vmultiple toplevel scopesError no pfxload for %v
bad insn in loadform: %xmust specify FPSCR(n)
%vunknown storex opcode %vNotNestedGreaterGreater;unexpected mantissa baseunexpected exponent baseRat.Scan: invalid syntaxruntime.goPanicSliceAlenruntime.goPanicSliceAcapruntime.mapassign_fast32runtime.mapassign_fast64runtime.mapdelete_fast32runtime.mapdelete_fast64runtime.loong64HasLAMCASruntime.loong64HasLAM_BHtype:*func(error) stringexec: Stdout already setexec: Stderr already setfunction props dump: %v
# scores for package %s
Callee is a closure: %+vempty type argument list or invalid array length%s literal has no digitsuse of untyped nil in %serror code must not be 0%s used as value or type%v: unexpected object %vambiguous selector %s.%sconstant %s overflows %sinvalid constant type %susing type constraint %sgoto %s jumps into blockmissing init expr for %sinvalid package name: %qcould not import %s (%s)invalid import path (%s)cannot rename import "C"%q imported and not usedinvalid receiver type %s%s declared and not usedcannot range over %s: %srequires go1.22 or laterrequires go1.23 or laterincorrect tag syntax: %q%s is not a generic type=> %s (under = %s) // %snot a go object file: %scounter: header mismatchmalformed profile formatFunction ID %d not found%d: %#x/%#x/%#x %s %s %sflate: maxBits too largeaux is of unknown type %Thttps://go.dev/issue/new
invalid store multiple %s=-= stack layout for %v:
expected pointer type: %vatomic load not availableunhandled binary op %v %sbad sized integer type %vbad sized complex type %vbad write barrier type %v<dt class="ssa-prog-src">unsupported broadcast: %vasmins: Zaut sb type ADDRasmins: unknown mov %d %vmissing runtime.sehtramp
%v missing from LHS of %vmakeslicecopy(%v, %v, %v)unknown internal map typeinvalid recursive type %vPosBase has no file index-- inlining tree for %s:
LoweredAtomicAdd64VariantLoweredAtomicAdd32VariantLoweredAtomicCas64VariantLoweredAtomicCas32VariantLoweredAtomicAnd64VariantLoweredAtomicAnd32VariantAtomicCompareAndSwapRel32late phielim and copyelimentry block %v is missing<div class="ast">%v</div>injecting attributes: %v
invalid newnode undo passload spill for %v from %vuses added in wrong orderentry block must be firstnil reg for value: %s
%s
zero-width instruction
%villegal base register: %vruntime.read_tls_fallbackinvalid register pair %v
goroutine profile cleanupchansend: spurious wakeup when attempting to open runtime·lock: lock countbad system huge page sizearena already initialized to unused region of spanunaligned sysNoHugePageOS/sched/gomaxprocs:threadsremaining pointer buffersruntime: epollwait on fd slice bounds out of range_cgo_thread_start missingallgadd: bad status Gidleruntime: program exceeds startm: p has runnable gsstoplockedm: not runnablereleasep: invalid p statecheckdead: no p for timercheckdead: no m for timerunexpected fault address missing stack in newstackbad status in shrinkstackmissing traceGCSweepStartCount of live goroutines.json: Unexpected key typereflect.Value.OverflowIntjson: unsupported value: reflect.Value.SetMapIndexreflect: Bits of nil Typereflect.StructOf: field "internal/runtime/exithook2910383045673370361328125no such file or directoryno such device or addressinvalid cross-device linkresource deadlock avoidedsocket type not supportedno buffer space availableoperation now in progress2006-01-02T15:04:05Z07:00error opening profile: %w=-= generated func is %v

	(*struct vs *interface)
	(*interface vs *struct)append outside assignmentindex bounds check elidedemptyInterfaceSwitchCachemisuse of method type: %vcannot slice %v (type %v)RewriteMultiValueCall %+vduplicate index in %s: %d%v already has a locationleaking param content: %vcalls param: %v derefs=%vunexpected type %v for %v%v: cannot inline %v: %s
marked go:cgo_unsafe_argslittleEndian.AppendUint16littleEndian.AppendUint32littleEndian.AppendUint64ORECOVER missed typecheck%v: Before inlining: %+v
locals table has desyncedunexpected types2.Invalidkey size too large for %vsigcmp vs sortinter %v %vnet/url: invalid userinfoError no pfxstore for %v
mishandled instruction %vbad RISC-V instruction %v%v: constant %d too largetoo many source registersillegal combination %v%v
cannot use index registerwas not expecting type %sbad Get: invalid registerbad Set: invalid registerbad Tee: invalid registernegative offset for *LoadClockwiseContourIntegral;DoubleLongLeftRightArrow;inconsistent poll.fdMutexruntime.panicmakeslicelenruntime.panicmakeslicecapruntime.goPanicSliceAlenUruntime.goPanicSliceAcapUruntime.goPanicSlice3Alenruntime.goPanicSlice3Acapruntime.slicebytetostringruntime.slicerunetostringruntime.stringtoslicebyteruntime.stringtosliceruneruntime.mapaccess1_fast32runtime.mapaccess1_fast64runtime.mapaccess2_fast32runtime.mapaccess2_fast64runtime.mapassign_faststrruntime.mapdelete_faststrruntime.memclrHasPointersruntime.checkptrAlignmentGODEBUG: can not enable "error parsing profile: %wclause %q: expected colonunexpected scalar tag: %vcontinue is not in a loopinvalid continue label %ssyntax error: unexpected empty type parameter listexpected := or = or commaexpected non-empty []byteargument to unsafe.Sizeofargument to unsafe.Stringinvalid recursive type %sinvalid use of AssertExpr%v: cannot instantiate %v%s does not %s comparablelabel %s already declared0o/0O-style octal literalpointer or interface typefunction body not ignoreddeclared and not used: %sunknown channel directioninvalid map key type %s%sreleaseLock %s: unlocked
%s%s-%s-%s-%s-%s.%s.countdecompressing profile: %vtesting simulated failurebranch not implemented: %s/gc/cycles/total:gc-cyclesfuncStack is non-empty: %vserializing pragcgobuf: %vInvertBranch: not a branch%s: too many return values%v has unexpected Class %vordered complex compare %vtype assertion not inlinedODOT's LHS is not a structfield offset doesn't matchreflect.Value.CanInterfaceTYPE_CONST with symbol: %vmalformed package path: %vProgs.SetText called twiceCalcSize: unknown type: %vNewArray: invalid bound %vssa types cannot be copied%0d | %0d | %s (%s) pc=%d
unindexed symbol referencefuncpctab %s [valfunc=%s]
LoweredAtomicStore8Variantearly phielim and copyelimphi after non-phi @ %s: %sCSE.large partition (%d): value %s still has %d usesvalue %s still has %d args...recur decompose %s, %v
<li class="ssa-end-block">parent=%s, update %s %s %sorig value set twice %s %sBegin processing block %v
%v is already set (v%d/%v)isNonNegative bad type: %vnilcheck still has %d usesstackalloc OpArg %s to %s
nil reg0 for value: %s
%s
SCOND_EQ = 0 ^ C_SCOND_XORSCOND_NE = 1 ^ C_SCOND_XORSCOND_HS = 2 ^ C_SCOND_XORSCOND_LO = 3 ^ C_SCOND_XORSCOND_MI = 4 ^ C_SCOND_XORSCOND_PL = 5 ^ C_SCOND_XORSCOND_VS = 6 ^ C_SCOND_XORSCOND_VC = 7 ^ C_SCOND_XORSCOND_HI = 8 ^ C_SCOND_XORSCOND_LS = 9 ^ C_SCOND_XORoffset must be zero in SWP%d is not a multiple of %dinvalid operation on op %voffset out of range: %d
%vinvalid operation %v in %vall goroutines stack traceSIGSTOP: stop, unblockableGC background sweeper waitcall from unknown functionnotewakeup - double wakeuppersistentalloc: size == 0use of invalid sweepLockernegative idle mark workersruntime: bad span s.state=runtime: consistent value=forEachP: P did not run fnwakep: negative nmspinningstartlockedm: locked to meinittask with no functionscorrupted semaphore ticketout of memory (stackalloc)shrinking stack in libcallruntime: pcHeader: magic= tracing is already enabledtraceRegion: out of memoryruntime: got trace reader reflect.Value.OverflowUintencountered a cycle via %s using unaddressable valueunknown ABI parameter kind using zero Value argumentreflect.Value.MethodByNamego object %s %s %s%s X:%s
1455191522836685180664062572759576141834259033203125no message of desired typeno CSI structure availableinvalid request descriptorname not unique on networkrequired key not available: day-of-year out of rangeinvalid argument to Int63ninvalid argument to Int31nunexpected initializer: %vwalkExpr init == &n->ninitunable to split string setinvalid comparison %v %s 0missing key in map literalDotField of non-struct: %Linvalid argument %L for %vautolabel outside functionmissing argument to %s: %vambiguous selector (%v).%vmethod mismatch: %v for %vnot enough arguments to %vexpected an error about %vunexpected fnsym: %v != %vcurrent scope is not emptyexpected function call: %vinlining call to %v failediteration-variable-to-heap
expected %v, reading at:
unexpected assignment: %+vpkg %s doesn't exist in %vunexpected type params: %v%v is not assignable to %velem size too large for %vtoo many methods on %v: %dfile changed between readsinvalid port %q after hostpprof: use of zero Profileunsupported data format %vunsupported instruction:%vsymbolAccess called for %sliteral operation on R0
%vbad opcode i/r or i/r/r %vunsupported name %d for %v%v: %v is not a TLS symbolbranch target too far awaycannot use indexed addressinput must not be R0 in %vbinary.Read: invalid type runtime.goPanicSlice3AlenUruntime.goPanicSlice3AcapUruntime.mapaccess1_faststrruntime.mapaccess2_faststrruntime.checkptrArithmeticruntime.libfuzzerTraceCmp1runtime.libfuzzerTraceCmp2runtime.libfuzzerTraceCmp4runtime.libfuzzerTraceCmp8Call isn't OCALLINTER: %+v%v:%v is out of bounds; %vassignment to _ identifierargument to unsafe.Alignof%s arguments in call to %s=> error: cycle is invalidmismatched types %s and %s(wrong type for method %s)(ambiguous selector %s.%s)incorrect type switch caseregister %s cas failed %p
string_table[0] must be ''build expression too large([A-Z][A-Z]+)\(([^)]+)\):?%s:%d: unknown directive %qunknown setting -spectre=%snon-canonical symbol name: setHeapaddr %L with type %vinteger constant too big %dos: unsupported signal typeos: process not initialized%s: invalid instruction: %vInitLSym called twice on %vunqualified symbol name: %vLoweredAtomicStore32VariantLoweredAtomicStore64Variantret block %s has successorsbad arg 0 to OpLocalAddr %vbad arg 1 to OpLocalAddr %vused block b%d in free listused value v%d in free listparam %v:
  [<entry>, %d]:
<td id="%v-exp" class="%v"><li class="ssa-value-list">Nil paramResultInfo, sym=%vinvalid aliasnode undo passProved slicemask not neededdropped from startRegs: %s
bad number of registers: %dv%d now available in %s:%s
bad float type with size %dstore aux is not a type: %sSCOND_GE = 10 ^ C_SCOND_XORSCOND_LT = 11 ^ C_SCOND_XORSCOND_GT = 12 ^ C_SCOND_XORSCOND_LE = 13 ^ C_SCOND_XORSCOND_NV = 15 ^ C_SCOND_XOR%v: constant is not in poolillegal system register:
%villegal source register: %vinvalid stp destination: %vunsupported instruction:%v
PageCachePagesLeaked (test)SIGILL: illegal instructionSIGXCPU: cpu limit exceededmakechan: size out of rangeG waiting list is corruptedM structure uses sizeclass runtime·unlock: lock countprogToPointerMask: overflow/gc/cycles/forced:gc-cycles/memory/classes/other:bytes/memory/classes/total:bytesfailed to set sweep barrierwork.nwait was > work.nproc not in stack roots range [allocated pages below zero?address not a stack addressmspan.sweep: bad span stateinvalid profile bucket typeruntime: corrupted polldescruntime: netpollinit failedruntime: asyncPreemptStack=runtime: thread ID overflowstopTheWorld: holding locksgcstopm: not waiting for gcruntime: checkdead: nmidle=runtime: checkdead: find g runlock of unlocked rwmutexsignal received during forksigsend: inconsistent statemakeslice: len out of rangemakeslice: cap out of rangegrowslice: len out of rangestack size not a power of 2: unexpected return pc for timer when must be positivebuild line with missing keyreflect.Value.OverflowFloatafter object key:value pairinvalid boolean flag %s: %vflag needs an argument: -%sreflect.Value.UnsafePointer is not assignable to type 363797880709171295166015625channel number out of rangecommunication error on sendnot a XENIX named type filekey was rejected by serviceinvalid argument to Shuffle=+= at instr %d kill of %v
Node %v has frameoffset %d
frame offset too big: %v %dedge [color=%s, style=%s];
unexpected shape for %v: %vclosure converted to globalbad: func %v has no linksymlarge ONEW with EscNone: %vslice: omit slice operationexpected %L to have type %vcase statement out of placeinvalid comparison %v %s %vTempAt called with nil typecannot call non-function %Lmissing arguments to appendmissing arguments to delete%v is both field and methodmutates param: %v derefs=%v%s:     from %v (%v) at %s
iteration-variable-to-stackmust have bodyReader for %vtype sym %v refers to alias%s: %v is not a field of %vinvalid alignment %d for %vunresolved defined type: %vdwarf: null reference in %dputAbstractScope(%v): vars:bad optab entry (17): %d
%vbad optab entry (18): %d
%vcannot generate mask #%x
%v but got non-%s register %s%v: illegal MOV instructionunexpected assembler op: %sabi.NewName: tag too long: runtime.goPanicSliceConvertruntime.mapassign_fast32ptrruntime.mapassign_fast64ptrruntime.unsafeslicecheckptrruntime.panicunsafeslicelenruntime.libfuzzerHookStrCmpruntime.asanregisterglobalshttpservecontentkeepheadersunexpected op %s in func %scmd/compile/internal/noder.break label not defined: %safter top level declarationexpected type argument listmissing type parameter nameexpected for loop conditionunexpected argument %v (%T)rune literal not terminatedoctal escape value %d > 255%s redeclared in this blockunknown syntax.Decl node %Tinitialization cycle for %sinvalid function literal %vinvalid lhs in range clauseoverlapping terms %s and %scan't find export data (%v)unexpected stub package: %vexpression nests too deeplycounter: missing build infoAdd %q += %d: nil extra=%d
lookup %s - no mapped file
counter: metadata too largeinconsistent mapping %p: %ddouble negation not allowedbad int register width %d:%vgenValue not implemented: %s%s/%s does not support -msan%s/%s does not support -asan%s/%s does not support -raceblockAsm not implemented: %s=-= %v to %v wrapper for %v
ctrlGroupMatchEmptyOrDeletedvar %L has size %d offset %dunknown indirect call familycan't find field in expr %v
bad int register width %d:%sos: process already finishedos: process already releasednon-retpoline-compatible: %vunexpected addr1: type=%d %vasmidx: bad address %d/%s/%s%v has offset against gotrefOuterValue needs type for %vunexpected constant kind: %v^go([1-9]\d*)\.(0|[1-9]\d*)$ambiguous priority %s and %scouldn't find field %s in %vexit block %s has successorsret block %s has nil controlbad bool AuxInt value for %vbad int8 AuxInt value for %vnilcheck must have 0 uses %s%v, arg %d of %s, is missingno last store found - cycle?unhandled op with sym effectMerging in state from %v:
%vWanted OpArg, instead saw %smemDefsAtBlockEnds[%s] = %s
bad reordering in looprotateno register available for %sphi %s not at start of blockruntime.memclrNoHeapPointersSPAnchored still has %d usesoffset against tls var in %voffset must be zero in LDREXoffset must be zero in STREXdiv already using REGTMP: %vinvalid stp destination: %v
SIGHUP: terminal line hangupSIGWINCH: window size changeGC mark assist wait for workcomparing uncomparable type runtime: bad lfnode address notewakeup - double wakeup (region exceeds uintptr range/gc/heap/frees-by-size:bytes/gc/heap/tiny/allocs:objects/sched/goroutines:goroutinesgcBgMarkWorker: mode not setmspan.sweep: m is not lockedfound pointer to free objectmheap.freeSpanLocked - span fatal: morestack on gsignal
runtime: casgstatus: oldval=gcstopm: negative nmspinningfindrunnable: netpoll with psave on system g not allowednewproc1: newg missing stacknewproc1: new g is not GdeadnewProfBuf: buffer too largeFixedStack is not power-of-2 args stack map entries for missing stack in shrinkstackinvalid runtime symbol tableruntime: no module data for mismatched isSending updates[originating from goroutine traceRegion: alloc too largejson: Unmarshal(non-pointer !#$%&()*+-./:;<=>?@[]^_{|}~ unexpected end of JSON inputreflect.MakeSlice: len > cap18189894035458564758300781259094947017729282379150390625protocol driver not attachedfile descriptor in bad statedestination address requiredunsupported compression for bad range elem %d:%d, en<=st=-= mergelocalsdumpfunc %v:
bad initial value for %L: %Linvalid unary operation %s%vcannot convert %L to type %vtoo many arguments to appendtoo many arguments to deleteunhandled declaration tag %vtoo many arguments to %s: %vseeking in output [0, 1]: %vconversion to unsafe.Pointerpath inconsistency: %v != %vmarked go:yeswritebarrierrecobject is [%s] expected [%s]usage: //go:cgo_ldflag "arg"misplaced compiler directivemisplaced go:embed directiveusage: //go:embed pattern...//%s only allowed in runtimealready generated wrapper %vfunc sym %v lookup error: %wwant interface type, have %L%v with length %v is too bigexpected global variable: %vcpu profiling already in useodd branch target address
%v%v: unsupported address loadabi.NewName: name too long: zero precision finite numberbig: misuse of expNNWindowednegative n for ProbablyPrimeruntime.slicebytetostringtmpruntime.unsafestringcheckptrruntime.panicunsafestringlenreflect: In of non-func typereflect: Key of non-map typemissing node from disp tableimport path must be a stringunexpected <-, expected chanunexpected %s, expected chanunexpected comma; expected ]missing channel element typecannot assign %s to %s in %scannot convert %s to type %s can only be compared to nil%s is not a method signature-- Named.expandUnderlying %s!"#$%&'()*,:;<=>?[\]^{|}`�unknown channel direction %dunexpected generic signatureinvalid operation: %s%s (%s)# telemetry/counter file v1
inconsistent function %p: %dunexpected end of expressioncrypto/aes: counter overflowfips140: verified code+data
-c must be at least 1, got %d%v: internal compiler error: %-16s%-12d%-6d%-6d%-8o%-10d`
error closing cpu profile: %vinternal error missing leaderblock %s >= f.NumBlocks()=%d?panic call can't have resultscan SSA LHS %v but not RHS %sbad ptr to array in slice %v
aux in %s not implemented %#vbad signed index extension %sunsupported setting GO386=%s
phase error in optab: %d (%v)runtime.asmcgocall_landingpad%s doesn't contain type splitNumComponents func arg structSoleComponent func arg structLoweredAtomicExchange8VariantAtomicCompareAndSwap32VariantAtomicCompareAndSwap64Variantinvalid ValAndOff.addOffset64block %s appears twice in %s!bad int16 AuxInt value for %vbad int32 AuxInt value for %vbad uint8 AuxInt value for %vtwo live mems @ %s: %s and %spasses %s and %s out of orderundecomposed named type %s %vExpected rc to have registersinvalid ValAndOff.addOffset32converted OpPhi bool -> int%dfindroot didn't find any rootlastidx index is not zero: %v[auxtype=%d AuxInt=%d Aux=%v]SCOND_NONE = 14 ^ C_SCOND_XORliteral span too large: %d
%vineffective ZR destination
%vbad constant for MOVK: %#x
%vMRS register value overlap
%vMSR register value overlap
%vSIGPIPE: write to broken pipeSIGPWR: power failure restartexecuting on Go runtime stackruntime: mmap: access denied
/cpu/classes/idle:cpu-seconds/cpu/classes/user:cpu-seconds/gc/heap/allocs-by-size:bytes/gc/stack/starting-size:bytesgc done but gcphase != _GCoffruntime: p.gcMarkWorkerMode= scanobject of a noscan objectruntime: marking free object addspecial on invalid pointerruntime: summary max pages = runtime: levelShift[level] = doRecordGoroutineProfile gp1=runtime: eventfd failed with tried to unpin non-Go pointerruntime: sudog with non-nil centersyscall inconsistent bp entersyscall inconsistent sp gfput: bad status (not Gdead)semacquire not on the G stackruntime: traceback stuck. pc=runtime: split stack overflowstring concatenation too longinvalid function symbol tabletrace: reading after shutdowntried to trace dead goroutineruntime: impossible type kindreflect: Key of non-map type reflect: In of non-func type reflect.Value.OverflowComplex cannot be converted to type debug.%s is missing help text45474735088646411895751953125too many open files in systemnumerical result out of rangemachine is not on the networkprotocol family not supportedoperation already in progressno XENIX semaphores availableTime.UnmarshalBinary: no datainvalid mergelocals state: %vbad index for entry point: %v"%v" -> "%v" [label="%.2f"];
bad: mapvar %v has no linksymOCALLMETH missed by typecheck(*interfaceType).MethodByNamefield inconsistency: %v != %vunhandled type switch case %vHaveInlineBody not overriddenbad conversion to untyped: %vconstant truncated to integerunexpected result op: %v (%v)too many arguments to recoverbufio.Scanner: token too longV%d: %s CI:%d II:%d IA:%d %s
assuming %v is unsafe uintptrusage: //go:%s local [remote]unexpected decoding error: %wunhandled assignee expressionreceiver %L does not match %L%L and %v are not shape typescannot call SetType(%v) on %Ldict %L, but shaped method %LDictIndex overflow for %v: %vfunc sym %v missing objReadertype sym %v missing objReaderunexpected encoding error: %vunexpected type expression %vunexpected selection kind: %vkey indirect incorrect for %vnon-method on %v method %v %vabi.TFlagOff() == %d, want %dunexpected branch encoding
%vunexpected op in rldc case
%vunexpected op in sldi case
%v%v requires memory for source%v: unsupported constant load%v: constant %d too large: %vunknown conditional branch %vexec: Wait was already calledreflect: Out of non-func typeclause %q: unknown adjustmentlabel %s defined and not usedmethod has multiple receivers must have no type parametersmissing statement after labelmissing { after switch clausemissing { after select clauseexpected case or default or }argument to unsafe.StringData%v: trace() without argumentsmethod %s.%s already declaredoperator %s not defined on %scannot %s %s (empty type set)underscore in numeric literalConfig.Importer not installedinvalid receiver type %s (%s)continue not in for statement /* with %s declared at %v */cannot use _ as value or typeinvalid character class rangecounter: corrupt counter fileAdd %q += %d: noptr extra=%d
FIPS 140-3 self-test failed: FIPS 140-3 self-test passed: crypto/aes: invalid key size load flags not implemented: %v%s/%s does not support -shared%s: unsupported result type %sfunction %v has unknown ABI %vtoo many ids for this functionaddr of canSSA expression: %+vmissing stack map index for %vbad float register width %d:%sjmp/branch/loop without targetWriteInt: bad integer size: %dinvalid value %q for -lang: %vLoweredAtomicExchange64VariantLoweredAtomicExchange32Variantbad %s type: want int, have %sbad %s type: want mem, have %sat %v: %v clobbered out of %v
  [%d, <end>): stackOffset=%d
phi of flags not supported: %scan't split flag generator: %s<div><strong>%v</strong></div><li class="ssa-long-value %s">aliasnewnode invalid argumentsaliasnode i2s contains n1 nodenon-empty root in undo newrootProved %v does not need fix-uplive at end, too many uses v%dnil register for value: %s
%s
%v: .COND on bcond instructioninvalid index shift amount: %vunsupported shift operator: %vinvalid offset on MOVW $tlsvarinvalid extended register: %v
illegal prefetch operation:
%vshift amount out of range: %v
assignment to entry in nil mapSIGUSR1: user-defined signal 1SIGUSR2: user-defined signal 2SIGVTALRM: virtual alarm clockSIGPROF: profiling alarm clock (types from different scopes)failed to get system page sizeruntime: found in object at *( in prepareForSweep; sweepgen /cpu/classes/total:cpu-seconds/gc/cycles/automatic:gc-cycles/sched/pauses/total/gc:seconds/sync/mutex/wait/total:seconds/godebug/non-default-behavior/runtime: totalMapped-released=runtime: epollctl failed with panic called with nil argumentcheckdead: inconsistent countsrunqputslow: queue is not fullruntime: bad pointer in frame invalid pointer found on stack locals stack map entries for abi mismatch detected between runtime: impossible type kind unsafe.Slice: len out of rangeunquoted key %q must be quotedlooking for beginning of valuein exponent of numeric literalcalled entry on non-entry nodeMapIter.Key called before Nextreflect: Elem of invalid type reflect: Out of non-func type strings: negative Repeat countruntime/internal/startlinetestprint help about SSA debugging227373675443232059478759765625inappropriate ioctl for devicesocket operation on non-socketprotocol wrong type for socketyear outside of range [0,9999]  =-= begin leader %d used=%s
=-= liveout from tail of b%d: not same expressions: %v != %vanylit: not lit, op=%v node=%vcan only handle non-interfacescannot use %L as type %v in %scannot convert %L to type %v%simpossible type assertion:
	%stoo many arguments to make(%v)leftover labels after walkFuncmarking %v as escaping uintptrrepeated recursive cycle to %sdoTyp returned nil for info=%vduplicate //go:linkname for %suse of uninstantiated type: %velem indirect incorrect for %vcannot move into constant 0
%vunexpected op in rldic case
%vencodeR4: instruction uses rs2%v is not a RISC-V instructionno encoding for instruction %s%v: unsupported unsigned storesquare root of negative numberruntime.panicunsafeslicenilptrruntime.libfuzzerHookEqualFoldGODEBUG: unknown cpu feature "sync: inconsistent mutex statesync: unlock of unlocked mutexreflect: Len of non-array type%v: unhandled op %s in func %vclause %q: malformed value: %vfailed to devirtualize %v (%v)%v: call %s:%d: no hot callee
label %s already defined at %scontinue label not defined: %sinvalid digit %q in %s literalcannot assign %s (in %s) to %scannot assign %s to %s (in %s)assignment mismatch: %s but %snon-name %s on left side of :=%s repeated on left side of :=Cannot change an existing nameunexpected list of expressions%s: unknown expression type %Tinvalid slice indices: %d < %dlabel %s declared and not usedincomparable types in type set%q imported as %s and not usedreceive from send-only channelinvalid embedded field type %sembedding interface element %sother declaration of method %scannot use comparable in unionvalidType(%s) nest %v, path %vunknown export data header: %qAdd %q += %d: locked extra=%d
register %s cas2 failed %p %p
fips: invalid self-test name: fips140: verification mismatchsubtle.XORBytes: dst too shortstore flags not implemented: %vcannot use both -race and -msancannot use both -race and -asancannot use both -msan and -asancannot write benchmark data: %verror closing trace profile: %vcannot use R0 as shift value %s%s:%d: invalid symabi type "%s"=-= weakify fn %v reloc %d %+v
no witness for reachable phi %sBlock %s should have a positionweird float conversion %v -> %vExpected to see a previous callassigning to non-1-length arraynode must be a map or a channelbad unsigned index extension %sfmt: unknown base; can't happenWriteOff: off overflow %d in %sprog: unknown position (line 0)nil symbol target in relocationunindexed symbol reference: %v
overflow in spadj: %d + %d = %d%s: unqualified symbol name: %shashed refs unsupported for nowTYPE_SHIFT is not supported on retjmp block %s has nil controlnilcheck must have void type %s%s has %d uses, but has Uses=%dmemory is first in a tuple: %s
<li class="ssa-start-block">%s:aliasnode for non-existing nodechildren of unknown node %d->%vshould not call Add with n1==n2couldn't find register to spilllive-at-end spill for %s at %s
process.OpLoadReg targeting g: PPC64 shift arg sh out of rangestackalloc value %s to name %s
value %s is not a phi operationoffset must be zero in MOVM; %vaddress constant needs DWORD
%vcannot use REGTMP as source: %vslice bounds out of range [:%x]slice bounds out of range [%x:]SIGSEGV: segmentation violationcall from within the Go runtimeinternal error - misuse of itab) not in usable address space: runtime: cannot allocate memorycheckmark found unmarked object/memory/classes/heap/free:bytes/memory/classes/os-stacks:bytespacer: sweep done at heap size non in-use span in unswept listruntime.Pinner: argument is nilcasgstatus: bad incoming valuesresetspinning: not a spinning mruntime: profBuf already closedfatal: bad g in signal handler
runtime: split stack overflow: ...additional frames elided...
unsafe.String: len out of rangeexpected 2 or 3 columns; got %djson: invalid number literal %qin literal true (expecting 'r')in literal true (expecting 'u')in literal true (expecting 'e')in literal null (expecting 'u')in literal null (expecting 'l') cannot produce iter.Seq[Value]reflect: Len of non-array type reflect.MakeSlice: negative lenreflect.MakeSlice: negative cap11368683772161602973937988281255684341886080801486968994140625.lib section in a.out corruptedcannot assign requested addressmalformed time zone information=-= raw cand list for func %v:
k=%q v=%+v slice len %d invalid=-= cands live before overlap:
%v %L recorded as live on entryOMAKESLICECOPY with EscNone: %villegal types for operand: %v%susefield %v %v without paramfld%v is not a top level statementvmkcall %v needs %v args got %vmkdotargslice: typecheck failedlen larger than cap in make(%v)mismatched arguments: %L and %LLookdot badwidth t=%v, f1=%v@%pcurfn mismatch: %v != %v for %vhot-callsite-thres-from-CDF=%v
expected receive expression: %v%L is not shape-identical to %vunsupported map key type for %vshape types have no methods %+vabi.CommonSize() == %d, want %dcan't write ptr, it has kind %scan't write int, it has kind %scan't call Elem on non-array %vexpected ABIInternal: %v has %vInitConst unhandled OLITERAL %villegal combination %v %v %v %vunexpected Prog in jalToSym: %v%v: unknown load instruction %vinvalid return from write: got Rat.GobDecode: buffer too smallsquare root of negative operandmergeRuneSets odd length []runeruntime.panicunsafestringnilptrruntime.libfuzzerTraceConstCmp1runtime.libfuzzerTraceConstCmp2runtime.libfuzzerTraceConstCmp4runtime.libfuzzerTraceConstCmp8reflect: NumIn of non-func typepackage statement must be firstcannot use %s as %s value in %simplicit function instantiationpackage %s; expected package %sgot operand instead of *operandtype %s of %s does not match %spossibly missing ~ for %s in %sduplicate key %s in map literalLookupFieldOrMethod on nil typeunderlying type must not be nillazy object has unexpected namemultiple defaults (first at %s)embedding non-interface type %sarray length %s must be integerterm cannot be a type parameterinvalid typecheck of range functabwriter: panic during %s (%v)invalidate %s: cleared havePtr
missing sample type informationfailed to compile regexp %s: %vwriteBytes with unfinished bitscrypto/aes: len(dst) < len(src)base.Flag.%s is uninitialized %verror closing memory profile: %vdeferStructFnField is %q, not fnzero for type %v not implementedgo/defer call with arguments: %vpidStatus called in invalid modephase error in avxOptab: %d (%v)unknown TLS base register for %vunknown TLS base location for %vheap closure, captured vars = %vmust call DeclParams on %v firstcannot supply data for %v var %vWriteAddr: off overflow %d in %semitting DWARF for %s failed: %vinvalid encoding for argument %vif block %s has no control value%s <span class="stats">%s</span>nil e, et=%v, et.Size()=%d, i=%d<span class="%s ssa-long-value">Branch prediction rule %s < %s%sphis in single-predecessor blocklive values at end of each blockfixed32 data not known for %s:%d  memory=v%d ptr=%v zeromask=%b
cannot use REGTMP as source: %v
%v is not a 12 bit immediate: %vslice bounds out of range [::%x]slice bounds out of range [:%x:]slice bounds out of range [%x::]SIGFPE: floating-point exceptionSIGTTOU: background write to tty (types from different packages)end outside usable address spaceruntime: fixalloc size too largeinvalid limiter event type foundscanstack: goroutine not stoppedscavenger state is already wiredsweep increased allocation countremovespecial on invalid pointerruntime: root level max pages = _cgo_pthread_key_created missingruntime: sudog with non-nil elemruntime: sudog with non-nil nextruntime: sudog with non-nil prevruntime: mcall function returnednon-Go code disabled sigaltstackruntime: newstack called from g=runtime: stack split at bad timepanic while printing panic valueinvalid quoted key in build linebuild line missing '=' after keyunquoted value %q must be quotedin literal false (expecting 'a')in literal false (expecting 'l')in literal false (expecting 's')in literal false (expecting 'e')MapIter.Value called before Nextreflect: NumIn of non-func type reflect.Value.Grow: negative len28421709430404007434844970703125sync: Unlock of unlocked RWMutexsync: negative WaitGroup counterresource temporarily unavailablenumerical argument out of domainsoftware caused connection abort: day-of-year does not match dayk=%s v=+%v slice value missing k=-= add final indUE v%d name %s
liveness cache initialized twiceclobberWalk: unexpected type, %v=-= mapassign %s %v rhs size %d
expression has untyped type: %+vwalkAddString count %d too smallbackingArrayPtrLen not cheap: %vUnknownBoolStringIntFloatComplexexplicit conversion missing typeconstant %v truncated to integerinfinity is not a valid constantinvalid type %v for OSLICEHEADERmissing len argument to make(%v)len for OMAKESLICECOPY too largenon-bool %L used as if conditioncannot use %L as type %v in %s%sinvalid slice index %v (type %v)too many arguments in call to %vinvalid use of ... in call to %vbufio: invalid use of UnreadBytebufio: invalid use of UnreadRunebufio: tried to fill full bufferrange [%d,%d) not contained in {inline.InlineCall not overridden%v: cannot inline %v: recursive
unexpected callee expression: %v%s (file declares //go:build %s)already have a definition for %vexpected implicit conversion: %vwrapper %L does not have type %verror parsing symbol name %q: %vwant non-interface type, have %vhash_iter size not correct %d %dabi.ITabTypeOff() == %d, want %dcan't write bool, it has kind %sbad class combination: %s %s,%s
illegal FPSCR/CR field number
%v%v: unknown store instruction %vCounterClockwiseContourIntegral;use of closed network connectionexpected end of string, found %q" not supported for cpu option "initial table capacity too largereflect: NumOut of non-func typeerror reading profile header: %wcallee %s is a method, skipping
in %s; possibly missing %s or %scannot use ... with %d-valued %scannot convert %s to type %s: %sconstant %s overflows %s (in %s)%v: %s should have been declaredcannot refer to unexported %s %sinvalid operation: %s %s %s (%s)%s (type %s) does not satisfy %scannot infer %s (declared at %v)(method %s has pointer receiver)(%s.%s is a field, not a method)=> %s (tparams = %s, under = %s)duplicate case %s in type switchincorrect expression switch case (missing comparable constraint)-- instantiating type %s with %sarray length %s must be constantfound mapping with reserved ID=0crypto/aes: input not full blocksubtle.XORBytes: invalid overlapcompile: unknown architecture %q
base.Flag.%s is missing help text%s: unsupported parameter type %s=-= merge locals state for %v:
%vunhandled shift op %v etype=%s/%sweird integer truncation %v -> %vweird complex conversion %v -> %vORESULT %v does not match call %srelease of handle with refcount 0-spectre=ret not supported on 386stack closure, captured vars = %vshould be something like "go1.12"type %L larger than address spaceembedded type cannot be a pointerprepwrite: bad off=%d siz=%d s=%vshould be used only in the linkerbranch out of range (%#x)
%v [%s]Flushplist called without PkgpathswapSuccessors with len(Succs)=%dvalue %s has %d args, expected %dvalue %v has *AuxCall with nil Fnbad type %T for S390XCCMask in %vunexpected floating-point type %v<ul class="%s ssa-print-func %s">should not call Equal with n1==n2non-empty root in undo changerootcan't find any output register %sbreaking cycle with v%d in %s:%s
can't find source for %s->%s: %s
v%d no longer available in %s:%s
fixedSym data not known for %s:%d-spectre=ret not supported on armcannot divide in NOSPLIT functioninvalid post-increment offset: %villegal destination register: %v
%v: unused constant in pool (%v)
invalid extended register op: %v
slice bounds out of range [%x:%y]SIGCHLD: child status has changedSIGTTIN: background read from ttySIGXFSZ: file size limit exceededbase outside usable address spaceruntime: memory allocated by OS [misrounded allocation in sysAlloc/cpu/classes/gc/pause:cpu-seconds/cpu/classes/gc/total:cpu-seconds/gc/limiter/last-enabled:gc-cycle/memory/classes/heap/stacks:bytes/memory/classes/heap/unused:bytes/sched/pauses/stopping/gc:seconds/sched/pauses/total/other:secondsmin must be a non-zero power of 2runtime: failed mSpanList.insert runtime: epollcreate failed with runtime: morestack on g0, stack [runtime: castogscanstatus oldval=stoplockedm: inconsistent lockingfindrunnable: negative nmspinningfreeing stack not in a stack spanstackalloc not on scheduler stackruntime: goroutine stack exceeds runtime: text offset out of rangetimer period must be non-negativetoo many concurrent timer firingsruntime: name offset out of rangeruntime: type offset out of rangeCount of all completed GC cycles.The stack size of new goroutines.bytes.Buffer.Grow: negative countinvalid value %q for flag -%s: %vreflect: slice index out of rangereflect: NumOut of non-func type  of method on nil interface valuereflect: Field index out of rangereflect: array index out of rangereflect.Value.Equal: invalid Kind to pointer to array with length bytes.Reader.Seek: invalid whence142108547152020037174224853515625710542735760100185871124267578125sync: RUnlock of unlocked RWMutextoo many levels of symbolic linksfollowers invoked on subsumed varunexpected integer size %d for %vwalkExpr: switch 1 unknown op %+vusemethod: unexpected dot.Op() %sorder.init shared node with ninitinvalid binary operation %v %s %vunexpected untyped expression: %vmissing type in composite literalinvalid composite literal type %vinvalid type %v for OSTRINGHEADERnon-bool %L used as for conditiontype %v has no receiver base type%v ignoring self-assignment in %vmarking %v as escaping ...uintptrmisplaced go:wasmimport directivemisplaced go:wasmexport directiveusage: //go:wasmexport exportname%s: unexpected type expression %v%v is missing its underlying typecan't call Field on non-struct %vabi.UncommonSize() == %d, want %dcan't write uint8, it has kind %scan't write int32, it has kind %scan't write slice, it has kind %sillegal register combination: %v
invalid offset against tls var %vframe size %d not a multiple of 8input must be even register in %vskip everything and stop the walkwaiting for unsupported file typeFloat.GobDecode: buffer too smallGODEBUG: no value specified for "concurrent map read and map writetable must have positive capacitytypebits.Set: unexpected type, %vhash/fnv: invalid hash state size*** cstab duplicate entry at: %s
missing call to ScoreCallsCleanuppartially devirtualizing %v to %vcallee %s is a closure, skipping
cannot fallthrough in type switch:!<-~||&&==!=<<=>>=+-|^*/%&&^<<>>cannot parenthesize embedded typemissing condition in if statementinvalid radix point in %s literalempty rune literal or unescaped 'invalid character %q in %s escapeinvalid argument: %s is not a mapgot %d type arguments but want %dfile requires newer Go version %v-- checking %s (%s, objPath = %s)type %s has no field or method %sindex %s must be integer constantindex %d is out of bounds (>= %d)%s implicitly parameterized by %sembedding constraint interface %suse of package %s not in selectorregexp: unhandled case in compilefound function with reserved ID=0found location with reserved id=0leafCounts[maxBits][maxBits] != ncrypto/aes: output not full blockUnexpected optimizer-logging levelInvalid source selection immediate%v defined in both Go and assemblyinvalid GOWASM: no such feature %qasmins: illegal in 64-bit mode: %vasmins: illegal in %d-bit mode: %vdeclared pointer receiver type: %v%v (%v) does not represent %v (%v)IsPaddedField called non-struct %vembedded pointer type has name: %Lproduced invalid special opcode %doverflow in PCDATA instruction: %vexit block %s has no control valueif block %s len(Succs)==%d, want 2wrong # of args for OpLocalAddr %sbad %s type: want uintptr, have %snilcheck must have pointer type %sat %v: stack-only var %v now live
at %v: stack-only var %v now dead
BP: Block %s, local=%s, certain=%scan't handle aux %s (type %d) yet
Mark stmt entry-block %s %s %s %s
newnode for Value already insertedposet not empty at the end of undonil tmp register for value: %s
%s
expected %d registers, got %d: %v.offset out of range [-256,255]: %vinvalid load of 32-bit address: %vmissing register at operand 2: %v
the immediate should be MOVCON: %vslice bounds out of range [:%x:%y]slice bounds out of range [%x:%y:]SIGURG: urgent condition on socketruntime: standard file descriptor out of memory allocating allArenas/memory/classes/heap/objects:bytesruntime.SetFinalizer: cannot pass too many pages allocated in chunk?mspan.ensureSwept: m is not lockedruntime: netpollBreak write failedforEachP: sched.safePointWait != 0schedule: spinning with local workentersyscallblock inconsistent bp entersyscallblock inconsistent sp runtime: g is running but p is notinvalid timer channel: no capacityinvalid quoted value in build linein \u hexadecimal character escapeflag provided but not defined: -%sreflect: Method index out of rangereflect: ChanDir of non-chan type reflect: Field of non-struct type reflect: Field index out of boundsreflect.FuncOf: too many argumentsreflect.StructOf: duplicate field " is anonymous but has PkgPath setreflect: string index out of rangereflect: recv on send-only channelreflect: send on recv-only channelreflect.Value.Grow: slice overflow3552713678800500929355621337890625too many references: cannot splice: day-of-year does not match month=-= add R_KEEP relo from %s to %s
maplit: entry is not a literal: %vno type specified for OSLICEHEADERinvalid use of ... with builtin %vinvalid type %v for OMAKESLICECOPYcannot typecheck interface data %vuse of .(type) outside type switchnot enough arguments in call to %vloop variable %v now per-iterationrequires go[0-9]+\.[0-9]+ or laterBenchmarkExportSize:%s 1 %d bytes
origin %v of %v has type argumentsmethods are too far away on %v: %dcan't write uint32, it has kind %scan't write uint16, it has kind %scan't write SymPtr, it has kind %sillegal arng type combination: %v
-spectre=ret not supported on mipscan't synthesize large constant
%v%v: jump displacement %d too largeimmediate %d cannot fit in 32 bits%v requires memory for destination%v: immediate out of range 0 to 63%v: immediate out of range 0 to 31require symbol to apply relocationinvalid offset against GOT slot %villegal base64 data at input byte msb not set in last word %#x of %sexpected exactly %d bits of resultRat.GobEncode: numerator too largeexecutable file not found in $PATHfallthrough statement out of placename %s not exported by package %s%s does not contain specific typesinvalid cycle in declaration of %sinvalid operation: cannot index %sinvalid operation: cannot slice %shexadecimal floating-point literalunderlying type must not be *Namedcannot declare init - must be funccannot declare main - must be funcno new variable on left side of :=multiple fields with the same nameinvalid nested repetition operatorinvalid or unsupported Perl syntaxmultiple mappings with same id: %dcrypto/aes: invalid buffer overlapbase.Flag.%s has unexpected type %s%s: invalid embedcfg: missing FilesNewPtr: pointer to elem Type is nilbuildssa: unknown position (line 0)bad integer sign extension %v -> %vOpConvert should be a no-op: %s; %sunexpected TYPE_ADDR with NAME_NONEWriteWeakOff: off overflow %d in %scopy %s: unexpected length %d != %ddefer block %s has no control valuecontrol value for %s is missing: %vinconsistent memory phi %s %d %s %sunable to determine the order of %sStarting %v with state from b%v:
%vat %v: overwrote %v in register %v
</div><div style="width: 92%"><pre>digraph "" { margin=0; ranksep=.2;  (disagrees with previous, ignored)should not call Ordered with n1==n2processDest.OpLoadReg targeting g: invalid PPC64 rotate mask: %x %d %dinstruction size too large: %d > %dfinal stage: pc invalid: %v size=%dliteral span too large: %d (R%d)
%v-spectre=ret not supported on arm64system register is not readable: %vsystem register is not writable: %vinvalid floating-point immediate
%vimpossible 32-bit move wide: %#x
%vimpossible 64-bit move wide: %#x
%vusing BECOME (%v) is not supported!persistentalloc: align is too large/memory/classes/heap/released:bytesgreyobject: obj not pointer-alignedmismatched begin/end of activeSweepattempt to clear non-empty span setmheap.freeSpanLocked - invalid freeruntime: close polldesc w/o unblockruntime: inconsistent read deadlinepidleput: P has non-empty run queuefindrunnable: netpoll with spinningtraceback did not unwind completely" is unexported but missing PkgPathreflect.MakeSlice of non-slice typestrings.Reader.Seek: invalid whence1776356839400250464677810668945312588817841970012523233890533447265625ryuFtoaFixed32 called with prec > 9network dropped connection on resettransport endpoint is not connected2006-01-02T15:04:05.999999999Z07:00wrong arg liveness map at block end=-= mergeVisitRegion(st=%d, en=%d)
can't find write barrier pattern %verror processing profile header: %wunexpected rhs, not an autotmp: %+vmissing lvalue case in safeExpr: %vgenAsStatic as.Left not typecheckedno type specified for OSTRINGHEADERarray index %d out of bounds [0:%d]non-integer len argument in %v - %vclosure variable never captured: %vzero-copy string->[]byte conversion%v does not escape, mutate, or callhot-cg before inline in dot format:import path cannot be absolute pathusage: //go:cgo_import_static localpackage %q has name %q, but want %qinlining closure call across frames%v must be nil or an interface typecan't write uintptr, it has kind %sruntime/pprof: converting profile: mismatched profile records and tagsbad r/r, r/r/r or r/r/r/r opcode %v%v needs an integer register output-spectre=ret not supported on riscv%v: unexpected AJALR with to symbol-spectre=ret not supported on s390xcannot use LARL with odd offset: %vcannot use EXRL with odd offset: %vinput argument must not be R0 in %vthird argument must not be R0 in %vRESUME can only be used on toplevelbad Get: argument is not a registerbad Set: argument is not a registerbad Tee: argument is not a registerfile type does not support deadline'_' must separate successive digitstypebits.Set: invalid alignment, %vpreprocessed profile missing headerclause %q has %d elements, wanted 2missing string argument after _Nameinvalid character %#U in identifiertype parameter bound more than oncecannot use %s as %s value in %s: %sno new variables on left side of :=invalid argument: %s is not a slicecannot call pointer method %s on %sillegal cycle in method declarationmethod %s.%s already declared at %vinvalid operation: division by zero%s (type %s) does not satisfy %s %sinvalid else branch in if statementgzip: invalid compression level: %dgzip.Write: Extra data is too largeincompatible period types %v and %vincompatible sample types %v and %vmultiple functions with same id: %dmultiple locations with same id: %dflate: corrupt input before offset usage: compile [options] file.go...
unknown width for load %d in type %vsetlineno: unknown position (line 0)pidDeactivate called in invalid modepath in $XDG_CONFIG_HOME is relativeillegal SAE with memory argument: %vinvalid auto-SPWRITE in non-assemblycan't call OffsetOf on non-struct %vWriteAddr: bad address size %d in %smakeFuncDebugEntry double process %vunknown aux combining for %s and %s
bad FlagConstant AuxInt value for %vsuccessor block %v for %v is missinglocatePrologEnd failed, skipping %v
Did not match param %v in prInfo %+v<span class="%s ssa-value">%s</span><span class="%s ssa-block">%s</span>should not call NonEqual with n1==n2should not call SetOrder with n1==n2x+d %s w; x:%v %v delta:%v w:%v d:%vmergeSym with two non-nil syms %v %vop %s doesn't have an int8 aux fieldop %s doesn't have a uint8 aux fieldop %s doesn't have a float aux fieldnil first register for value: %s
%s
shift amount out of range 0 to 4: %vREGTMP used in large offset load: %vimmediate constant out of range: %v
branch too far %#x vs %#x [%p]
%v
%vunsupported register extension type.lfstack node allocated from the heap) is larger than maximum page size (runtime: invalid typeBitsBulkBarrieruncaching span but s.allocCount == 0/memory/classes/metadata/other:bytes/sched/pauses/stopping/other:secondsuser arena span is on the wrong listruntime: marked free object in span runtime: unblock on closing polldescruntime: inconsistent write deadlineruntime: netpoll: eventfd ready for runtime: sudog with non-nil waitlinkruntime: mcall called on m->g0 stackfatal: recursive switchToCrashStack
startm: P required for spinning=true) is not Grunnable or Gscanrunnable
runtime: bad notifyList size - sync=signal arrived during cgo execution
accessed data from freed user arena runtime: wrong goroutine in newstackruntime: invalid pc-encoded table f=timer moved between synctest bubblesjson: encoding error for type %q: %qinvalid boolean value %q for -%s: %vmethod ABI and value ABI don't alignreflect.Value.Equal: values of type strings.Builder.Grow: negative countstrings: Join output length overflowbytes.Reader.ReadAt: negative offsetbytes.Reader.Seek: negative positioninvalid pattern syntax (+ after -): 444089209850062616169452667236328125ryuFtoaFixed64 called with prec > 180123456789abcdefghijklmnopqrstuvwxyzaccessing a corrupted shared libraryTime.UnmarshalBinary: invalid lengthbad live variable at entry of %v: %L=-= rejected %v due to side effects
=-= outlined %v map initializations
walkRange: v2 != nil while v1 == nilneed unsafe.Pointer for OSLICEHEADERlen larger than cap for OSLICEHEADERno type specified for OMAKESLICECOPYLookupRuntime: can't find runtime.%sRewriteMultiValueCall: invalid op %vcannot assign to %v (declared const)failed to locate precursor fn for %vnot inlining functions with closuresnot implemented yet for node type %v%s loop ending at %d:%d was modifiedinfinite recursion in makeSrcPosBasetype sym %v refers to interface typeisInterface inconsistency: %v and %vbad alignment of keys in bmap for %vabi.StructFieldSize() == %d, want %delement index %d out of range [0:%d]putInlinedFunc(callee=%v,abbrev=%d)
file too large (%d bytes > %d bytes)Unexpected nonzero FCONST operand %vunrecognized register: expecting CR
invalid offset for GOT/TOC access %vsecond argument must not be R0 in %voutput argument must not be R0 in %vmultiplication of zero with infinitywriteStringRef: string not added: %qreflect: NumField of non-struct typepsNoInfopsCallsPanicpsMayReturnpsTopexpected field name or embedded typeinternal error: unknown node type %Tinvalid argument: %s for built-in %smissing argument in conversion to %sconstant result is not representablecannot convert %s to type %s (in %s)cannot convert %s (in %s) to type %sinvalid case %s in switch on %s (%s)func %s must have no type parameterscrypto/cipher: input not full blocksaux in MOVDaddr is of unknown type %Tunknown width for store %d in type %vnon-intrinsic AS2FUNC not expanded %vintrinsic substitution for %v with %sliteral with nonzero value in SSA: %vweird integer sign extension %v -> %vunexpected TYPE_ADDR with NAME_GOTREFDo not know how to compare %v with %vWriteString: bad string size: %d < %dmultiple definitions for FUNCDATA $%dtoo many instructions, have %d max %dplain block %s len(Succs)==%d, want 1plain block %s has non-nil control %sdefer block %s len(Succs)==%d, want 2value %v has Aux type %T, want stringtrying to free an already freed valuetrying to free an already freed block<div class="lines" style="width: 8%"><div class="l%v line-number">%v</div> id="%s" onload="makeDraggable(evt)" Branch prediction rule stay in loop%sposet not empty after function %s: %vallocValToReg.OpLoadReg targeting g: u is nil, v = %s, s.values[v.ID] = %vop %s doesn't have an int16 aux fieldop %s doesn't have an int32 aux fieldnil second register for value: %s
%s
%d is not a 24 bit unsigned immediateshift amount out of range 0 to 31: %vunexpected long move, op %v tab %v
%vREGTMP used in large offset store: %villegal immediate for PSTATE field
%vinvalid arrangement, should be D2: %vextraneous register at operand 2: %v
runtime: allocation size out of range) is smaller than minimum page size (/cpu/classes/gc/mark/idle:cpu-secondssetprofilebucket: profile already setfailed to reserve page summary memory_cgo_notify_runtime_init_done missingfatal: concurrent switchToCrashStack
startTheWorld: inconsistent mp->nextpruntime: unexpected SPWRITE function all goroutines are asleep - deadlock!bytes.Buffer: truncation out of rangereflect: Bits of non-arithmetic Type reflect: NumField of non-struct type reflect: IsVariadic of non-func type reflect: OverflowInt of non-int type reflect: funcLayout of non-func type reflect.Value.Bytes of non-byte slicereflect.Value.Bytes of non-byte arrayreflect.Value.Bytes of non-rune slicemethod ABI and value ABI do not alignreflect.Value.Convert: value of type bisect.Hash: unexpected argument type2220446049250313080847263336181640625value too large for defined data typecannot exec a shared library directlyoperation not possible due to RF-killtimezone hour outside of range [0,23]=-= pruned candidate list for fn %v:
 %d: %s %q sz=%d hp=%v align=%d t=%v
pgoir.LookupMethodFunc not overriddenskipping static copy of %v+%v with %v=-= skipping %v size too small at %d
cannot refer to blank field or methodneed unsafe.Pointer for OSTRINGHEADERusage: //go:cgo_dynamic_linker "path"skipping shaping of recursive type %vunresolved composite literal type: %verror looking up method symbol %q: %vunexpected composite literal type: %vbad alignment of elems in bmap for %v-spectre=ret not supported on loong64illegal combination %v %v %v %v %v %v21 bit-width, short branch too far
%v16 bit-width, short branch too far
%vInvalid me or sh for RLDICR: %x %x
%vInvalid n or b for CLRLSLDI: %x %x
%vInvalid n or b for CLRLSLWI: %x %x
%villegal syscall, sysnum too large: %vencodeR: could not encode instructionencodeI: could not encode instructionencodeS: could not encode instructionencodeB: could not encode instructionencodeU: could not encode instructionencodeJ: could not encode instruction%v: address load must target registerPC-relative relocation missing symbolmask (%v) must be in the range [0, 7]exec: StdinPipe after process startedgodebug: unexpected IncNonDefault of final index required in 3-index sliceinvalid BOM in the middle of the file%q exponent requires decimal mantissainvalid argument: %s is not a pointer-- instantiating signature %s with %sinvalid operation: cannot indirect %sinvalid argument: %s %s overflows intinvalid composite literal%s type %s%snon-boolean condition in if statementinvalid use of ~ (%s is an interface)not the start of an archive file (%q)gzip.Write: non-Latin-1 header stringcipher: message authentication failedcrypto/cipher: invalid buffer overlap(?i)^[[:space:]]*(unordered )?output:bad reg %s for symbol type %T, want %serror reading -coveragecfg file %q: %v%s: invalid embedcfg: missing Patternscould not open hash-testing logfile %scompiler not built with support for -twasmexport function argument too largeasmins: illegal in mode %d: %v (%d %d)channel element type too large (>64kB)crypto/internal/fips140/check.linkinfo%s: invalid relocation %v in fips codeHash of non-content-addressable symbolshort hash of non-default-section sym NumberSyms called without package pathretjmp block %s len(Succs)==%d, want 0predecessor block %v for %v is missingProved %v's arg %d (%v) is constant %dnil v, s.orig[%d], vi = %v, spill = %sconstrained unpredictable behavior: %vindex out of range [%x] with length %ymakechan: invalid channel element typeunreachable method called. linker bug?concurrent map iteration and map writegcBgMarkWorker: blackening not enabledcannot read stack of running goroutineruntime: blocked read on free polldescruntime: sudog with non-false isSelectarg size to reflect.call more than 1GBv could not fit in traceBytesPerNumberafter decimal point in numeric literalflag %s set at %s before being definedreflect.typeptrdata: unexpected type, reflect: close of receive-only channelreflect: Method on nil interface valuestrings.Reader.ReadAt: negative offsetstrings.Reader.Seek: negative positionstrings: Repeat output length overflowdebug.ConcurrentOk must have type bool1110223024625156540423631668090820312555511151231257827021181583404541015625can not access a needed shared librarytime: missing Location in call to Dateduplicate var %q in vslots: %d and %d
=-= add indirectUE(%s) count=%d on %s
pgoir.PostLookupCleanup not overriddenerror processing pprof PGO profile: %wmethodValueWrapper: unexpected %v (%v)assigning %L to parameter %v (type %v):
	%v is incomplete (or unallocatable)SubstArgTypes: too many argument typesuse of builtin %v not in function call%v: inlining call to %v with score %d
%s (-lang was set to %s; check go.mod)go:embed cannot apply to multiple varscannot use //go:wasmexport on a methodruntime dictionary of shaped object %v%v has object %v, but %v has object %vhmap size not correct: got %d, want %dcan't call ModifyArray on non-array %vno NT_GNU_BUILD_ID found in ELF binarySPR move to memory will clobber R31 %vimmediate %#x is not a multiple of twoencodeR4: could not encode instruction%v: constant load must target registerarch-specific Castagnoli not availableexec: StdoutPipe after process startedexec: StderrPipe after process startederror reading preprocessed profile: %w: should not PGO devirtualize functionmiddle index required in 3-index sliceidentifier cannot begin with digit %#Uinvalid argument: %s cannot be orderedinvalid argument: %s is a method valueinvalid use of ... in conversion to %stoo many arguments in conversion to %sfield and method with the same name %sinvalid operation: more than one indexexpression in %s must be function callrequires function call, not conversionduplicate case %s in expression switchnon-boolean condition in for statementcrypto/sha256: invalid hash state sizecorrupt: limit %d exceeds file size %d%s:%d: invalid symabi: unknown abi "%s"value %v (%v) incorrectly live at entrycannot read sources for function %v: %vOCALLINTER: n.Left not an ODOTINTER: %vmemory no longer live from dottype loadinvalid GOAMD64: must be v1, v2, v3, v4unexpected frame pointer instruction
%vinlined call has %v results, expected 1InitTypes called before PtrSize was setplain/dead block %s has a control valuejumpTable block %s has no control valuevalue %v has Aux type %T, want *AuxCallbad type %T for S390XRotateParams in %vbad arg 1 type to %s: want mem, have %sbad arg 2 type to %s: want mem, have %sbad arg 0 type to %s: want ptr, have %stwo live memory values in %s: %s and %slive values in unreachable block %v: %vAdd entry for %v: 	b%vv%v-b%vv%v = 	%v
Saw two memories for call %v, %v and %v<span class="no-line-number">(?)</span>should not call SetNonEqual with n1==n2can't pick a register from an empty setcan't move a value with a memory arg %sodd offset for floating point op: %d
%vbad split for %x with shift %v (%x, %x)mismatched count during itab table copyout of memory allocating heap arena map/cpu/classes/gc/mark/assist:cpu-seconds/cpu/classes/scavenge/total:cpu-seconds/memory/classes/profiling/buckets:bytesmspan.sweep: bad span state after sweepruntime: blocked write on free polldescruntime.Pinner: object already unpinnedsuspendG from non-preemptible goroutineruntime: casfrom_Gscanstatus failed gp=stack growth not allowed in system calltraceback: unexpected SPWRITE function traceRegion: alloc with concurrent dropbuild line missing '=' after quoted key cannot produce iter.Seq2[Value, Value]reflect: OverflowUint of non-uint type reflect.MakeMapWithSize of non-map type277555756156289135105907917022705078125transport endpoint is already connectedSetctty set but Ctty not valid in childsyscall.releaseForkLock: negative count2006-01-02 15:04:05.999999999 -0700 MSTunexpected initialization statement: %vassignment operands mismatch: %+v / %+vunexpected type in deref expression: %vmissing second (key) argument to deletemissing len argument for OMAKESLICECOPYSetBaseTypeIndex on non-defined type %vcannot assign to struct field %v in mapleaking param: %v to result %v level=%dparameter %v leaks to %s with derefs=%dmarked go:norace with -race compilation//%s only allowed in cgo-generated codeinvalid quoted string in //go:embed: %stype sym %v refers to non-type name: %vmethod %s missing from method set of %vgo:uintptrkeepalive requires go:nosplitgo:embed cannot apply to var of type %voffsetToSpillArea: %d spillAreaSize: %dmath/big: buffer too small to fit valueexec: environment variable contains NULhash/fnv: invalid hash state identifier%v: should not PGO devirtualize %v: %s
goto %s jumps into block starting at %scannot fallthrough final case in switchsyntax.Iterate: unexpected node type %Tmore than one character in rune literalcannot assign to struct field %s in mapinvalid argument: %s %s must be integerinvalid field name %s in struct literal(missing method %s)
		have %s
		want %sstruct containing %s cannot be comparedembedded field type cannot be a pointernegative minwidth, tabwidth, or paddingmissing argument to repetition operatortrailing backslash at end of expressioncounter: writing file did not extend itcorrupt: failed to remap after 10 triesfips140: no verification checksum foundcalled Uint64 on non-uint64 metric valueintrinsic already exists for %v.%v on %vexpected ONAME or OCLOSURE node, got %+vwrite barrier prohibited by caller; %v%sappend: len-only update (in local slice)defer call with arguments or results: %vunexpected TYPE_ADDR with index==REG_TLScannot add hidden parameters to closuresSubstArgTypes: not enough argument typesDwarfFixupTable.Finalize invoked for %s
a symbol is added to defs multiple timescontrol value %s for %s doesn't dominateError %s in regexp for phase %s, flag %sdecomposeComplexPhi: bad complex size %dcached const %s should have AuxInt of %dloop finding    succ %s of %s is header
unreachable, ind: %v, start: %v, end: %vcan't find empty register on edge %s->%s%s appeared outside of entry block, b=%sop %s doesn't have a ValAndOff aux fielduse R_ADDRARM64 relocation type for: %v
invalid span in heapArena for user arenarefill of span with free space remainingbulkBarrierPreWrite: unaligned argumentsruntime: typeBitsBulkBarrier with type  /cpu/classes/scavenge/assist:cpu-secondsruntime.SetFinalizer: first argument is markWorkerStop: unknown mark worker modefailed to acquire lock to reset capacitycannot free workbufs when work.full != 0runtime: out of memory: cannot allocate runtime: netpollBreak write failed with stopTheWorld: broken CPU time accountingmust be able to track idle limiter eventglobal runq empty with non-zero runqsizegoroutine stack size is not a power of 2MapIter.Key called on exhausted iteratorreflect: FieldByName of non-struct type reflect.Value.Call: call of nil functionreflect.Value.Call: wrong argument countattempted to copy pointer to FP registerreflect.Value.SetBytes of non-byte slicereflect.Value.setRunes of non-rune slice13877787807814456755295395851135253906256938893903907228377647697925567626953125ryuFtoaFixed32 called with negative precaddress family not supported by protocoltime: Stop called on uninitialized Timerbad range elem %d:%d overlaps prev %d:%dbvequal: lengths %d and %d are not equalinlined call result has side effects: %vwalkSelectCases: miscount: %v + %v != %vinvalid operation: %v (shift of type %v)use NewMethodExpr to construct OMETHEXPRinvalid operation: %v (non-chan type %v)non-integer %s argument in make(%v) - %vCanInline on non-typechecked function %vcost %d of %s exceeds max caller cost %drecursive call to closure parent: %s, %simport path contains space character: %qgo:embed cannot apply to var inside funcoldBase %v already has inlining index %v%s is not a function (%v) or method (%v)receiver with no type on %v method %v %vheap profile: %d: %d [%d: %d] @ heap/%d
don't know how to handle %v with -sharedillegal combination %v %v %v %v %v %v %vinvalid offset for DS form load/store %vunrecognized register: expected CR0-CR7
invalid offset for DQ form load/store %vunknown destination type %+v in CALL: %vtoo many RestArgs: got %v, maximum is 3
target must be an even-numbered registeropening function props dump file %q: %v
malformed -d=inlscoreadj argument %q: %vunexpected semicolon or newline before {escape is invalid Unicode code point %#Uinvalid use of %s in selector expressiontype parameter %s cannot use operator %sinvalid operation: signed shift count %s%s already declared through import of %scannot use iteration variable of type %scounter: disabled as Go telemetry is offreleaseReader %s: last reader, need ptr
mismatched scale ratios, got %d, want %dcrypto/cipher: output smaller than inputGOARCH=%s does not support -spectre=indexCONVNOP sign mismatch %v (%s) -> %v (%s)
KeepAlive variable %v must be Auto or Argaddr of undeclared ONAME %v. declared: %vvariable address class %v not implementedunexpected call to os.Exit(0) during testillegal rounding with memory argument: %vdon't know how to handle %v with -dynlink args=%#x locals=%#x funcid=%#x align=%#xif block %s has non-bool control value %svalue %v has an AuxInt that encodes a NaNUnable to create after-phase dump file %s    check, all, build, intrinsics, genssaLost statement marker in %s on former %s
cannot have multiple controls using flags<div class="l%v line-number ast">%v</div><span class="l%v line-number">(%s)</span>two stores live simultaneously: %v and %vtruncate64Fto32F: truncation is not exactPhase SCCP for %v : %v constants, %v dce
PC padding invalid: want %#d, has %#d: %v closed, unable to open /dev/null, errno=runtime: typeBitsBulkBarrier without type/memory/classes/metadata/mspan/free:bytesruntime.SetFinalizer: second argument is gcSweep being done but phase is not GCoffobjects added out of order or overlappingmheap.freeSpanLocked - invalid stack freemheap.freeSpanLocked - invalid span stateattempted to add zero-sized address rangeruntime: blocked read on closing polldescstopTheWorld: not stopped (stopwait != 0) received on thread with no signal stack
invalid timer: fake time but no syncgroupunexpected character after quoted key: %qcan't call pointer on a non-pointer ValueMapIter.Next called on exhausted iteratorreflect: FieldByIndex of non-struct type reflect: OverflowFloat of non-float type reflect.Value.Addr of unaddressable valuebytes.Buffer.WriteTo: invalid Write countbytes.Reader.WriteTo: invalid Write count34694469519536141888238489627838134765625strconv: illegal AppendInt/FormatInt baseclone(CLONE_PIDFD) failed to return pidfdtime: Reset called on uninitialized Timertime: missing Location in call to Time.InTime.UnmarshalBinary: unsupported versionstaticassign of const generated code: %+vlen for OSLICEHEADER must be non-negativecap for OSLICEHEADER must be non-negativemultiple defaults in select (first at %v)multiple defaults in switch (first at %v)%v is pointer to interface, not interfacedictionary variable not captured by valueusage: //go:linkname localname [linkname]go:embed cannot apply to var without typewant receiver type %v, but have method %Lbucket align not multiple of key align %vunexpected alignment in dextratype for %vnet/url: invalid control character in URLinternal: bad register move/truncation
%vdo not know how to handle TYPE_ADDR in %vinvalid suffix, require round mode bit:%x%v: expected %s register in %s position%snumber of bytes (%v) not in range [1,256]nonzero finite number with empty mantissapreprocessed profile entry missing calleepreprocessed profile entry missing weight%v: PGO devirtualize considering call %v
break is not in a loop, switch, or selectunexpected %s, expected { after if clause%q exponent requires hexadecimal mantissaassignment mismatch: %s but %s returns %scannot use ... in call to non-variadic %sgeneric function is missing function bodycannot use a type parameter as constraintinvalid operation: invalid shift count %sinvalid operation: %s is not an interfacemultiple-value %s in single-value contextinitialization cycle: %s refers to itselfmethods must have a unique non-blank nameduplicate field name %s in struct literalNamed.check == nil but type is incompleteunification reached recursion depth limitreleaseLock %s: reset havePtr (extra=%d)
fips140: unknown GODEBUG setting fips140=output not in same register as an input %sunknown float width for load %d in type %vlocal variable with class %v unimplementedCONVNOP width mismatch %v (%d) -> %v (%d)
CONVNOP unrecognized non-integer %v -> %v
type skew: %v has type %v, but expected %vinternal error parsing default lang %q: %vwasmimport aux sym must have non-zero size%s: symbol too large (%d bytes > %d bytes)plain/dead block %s len(Succs)==%d, want 2value %s has an Aux value %v but shouldn'tentry block %s of %s has predecessor(s) %vGenerating location lists for function %q
at %v: arg %v now on stack in location %v
at %v: %v spilled to stack location %v@%d
Skipping empty location list for %v in %s
needCloCtx is true for func %q, cloreg=%v
 <span class="l%v line-number">(%s)</span>loop finding    succ %s of %s has no loop
unexpected induction with too many parentstried to free an already free register %d
val %s is in reg but not live at end of %ssource operand is not a memory address: %vsource register must be even in STREXD: %villegal PSTATE field for immediate move
%vinvalid CASP-like atomic instructions: %v
 bytes; incompatible with mutex flag mask persistentalloc: align is not a power of 2out of memory allocating checkmarks bitmap/cpu/classes/gc/mark/dedicated:cpu-seconds/memory/classes/metadata/mcache/free:bytes/memory/classes/metadata/mspan/inuse:bytesnon-empty mark queue after concurrent marksweep: tried to preserve a user arena spanruntime: blocked write on closing polldescacquireSudog: found s.elem != nil in cachefatal error: cgo callback before cgo call
on a locked thread with no template threadunexpected signal during runtime execution received but handler not on signal stack
stop of synctest timer from outside bubbletraceInitReadCPU called with trace enabledtraceStopReadCPU called with trace enabledattempted to trace a bad status for a procexpected 3 columns for replacement; got %dcould not parse Go build info: line %d: %wlooking for beginning of object key stringMapIter.Value called on exhausted iteratorreflect: negative length passed to ArrayOfreflect: Call with too few input argumentsmismatch between ABI description and typesreflect: cannot convert slice with length PosBase already registered with a PosTable173472347597680709441192448139190673828125867361737988403547205962240695953369140625Time.MarshalBinary: unexpected zone offsetinternal error: call to runtimeSource.Seed=+= at instr %d block boundary kill of %v
=+= at block-end instr %d %v becomes live
=+= at instr %d upwards-exposed use of %v
common predecessor block the wrong type %saddIndirectEdges: %s found in export data
"%v" [color=black, style=%s, label="%v"];
tracked field must be in named struct typeduplicate field name in struct literal: %slen for OSTRINGHEADER must be non-negativecannot use ... on first argument to appendnon-integer len argument in OMAKESLICECOPYunexpected (no init func for -cover build)unexpected: got metahash length %d want 32%v escapes to heap, not allowed in runtimeimport path contains control character: %qfailed to find method %v in shaped type %vcannot find type of destination object: %vbucket align not multiple of elem align %vdo not know how to handle nil symbol in %vregister out of range, want %d <= %d <= %dencodeR4: funct2 requires more than 2 bits%v does not fit into 20-bit signed integerinput argument must be even register in %vthird argument must be even register in %vaddition of infinities with opposite signssubtraction of infinities with equal signstypebits.Set: invalid TARRAY alignment, %vcannot devirtualize %v: shaped receiver %vgoto %s jumps over declaration of %s at %sexpression in %s must not be parenthesized%s.%s undefined (type %s has no method %s)invalid operation: negative shift count %sinvalid operation: 3-index slice of stringresult parameter %s not in scope at returncannot switch on %s (%s is not comparable)type in term %s cannot be a type parameter%v: could not create telemetry.LocalDir %sexpression too complex for // +build lines-env argument must be of the form key=valueCould not parse %s (=%s) as a binary numberunknown float width for store %d in type %vUnexpected number of controls (%d != 2): %sUnexpected number of controls (%d != 1): %sopenDeferSave of pointerless type %v val=%vinput[0] and output not in same register %sinput[0] and output in the same register %sinput[1] and output in the same register %sneed a third arg for gather instruction: %vmissing frame pointer instruction: PUSHQ BPduintxxLSym: misaligned: v=%d wid=%d off=%d%s: invalid relocation %v in fips data (%v)value %s has non-final memory arg (%d < %d)bad arg 2 type to %s: want boolean, have %sbad arg 1 type to %s: want integer, have %sMark stmt effectively-empty-block %s %s %s
ARM(64) bit field lsb constant out of rangearg of tuple selector %s is not a tuple: %szero shifts cannot be handled correctly: %vruntime: opened unexpected file descriptor /memory/classes/metadata/mcache/inuse:bytesruntime.SetFinalizer: first argument is nilruntime.SetFinalizer: finalizer already setgcBgMarkWorker: unexpected gcMarkWorkerModenon in-use span found with specials bit setgrew heap, but no adequate free space foundroot level max pages doesn't fit in summarymeasures of the retained heap are not equalruntime.Pinner: argument is not a pointer: runtime: releaseSudog with non-nil gp.paramunknown runnable goroutine during bootstrapruntime: casfrom_Gscanstatus bad oldval gp=runtime:stoplockedm: lockedg (atomicstatus=methodValueCallFrameObjs is not in a modulereset of synctest timer from outside bubblesynctest timer accessed from outside bubbletraceSnapshotMemory: tracing is not enabledGcSlice can't handle on-demand gcdata typesreplacement with no module on previous linereflect: nil type passed to Type.Implementsreflect: CallSlice of non-variadic functionreflect: Call with too many input argumentsmultiple Read calls return no data or errormult64bitPow10: power of 10 is out of rangeinterrupted system call should be restartederror processing serialized PGO profile: %w%s.%s expects %d arguments, but received %dimportsym of symbol that already exists: %vinvalid field name %v in struct initializerinvalid use of ... in type conversion to %vcannot call non-function %L, declared at %smultiple-value %v() in single-value contextlen for OMAKESLICECOPY must be non-negativeinvalid operation: %v (non-numeric type %v)cannot assign to %v (strings are immutable)bufio: tried to rewind past start of buffernon-canonical import path %q (should be %q)//%s is not allowed in the standard librarytail call emitted for the method %v wrapperfunc sym %v refers to non-function name: %velem align %d too big for %v, BUCKETSIZE=%dkey size not a multiple of key align for %velement access out of bounds [%d] in [0:%d]invalid mask for rotate: %x (start != 0)
%vinvalid mask for shift: %x %x (shift %d)
%vunreachable case in rewriteToUseTOC with %vsecond argument must be even register in %vexec: WaitDelay expired before I/O completecalculateCostForType: unexpected slice typeinternal error unregistered adjustment type=-= *** unable to score call to %s from %s
cannot devirtualize %v: shaped interface %vinvalid argument: %s has no single field %sinvalid recursive type: %s refers to itself2nd and 3rd index required in 3-index sliceexcessively long constant: %s... (%d chars)too few values in struct literal of type %sreleaseLock %s: flush extra=%d -> count=%d
refresh %s: havePtr=%v readers=%d extra=%d
impl: package name must not contain slashesLoweredGetG should not appear in ABIInternalFlag* ops should never make it to codegen %vopenDeferSave of non-SSA-able type %v val=%vinvalid GOMIPS: must be hardfloat, softfloatsetAlg(%v,%s) starting with unknown prioritySetFields of %v: width previously calculatedret block %s has non-memory control value %sarg %d of value %s does not dominate, arg=%spanic during %s while compiling %s:

%v

%s
Cannot use sentinel value -0x80000000 as keyMerging %v into %v (changed=%d, checked=%d)
Too many fields (%d, %d bytes), container=%sExpected container OpSelectN, saw %v instead<button onclick="hideBlock(this)">-</button>register allocated parameters have no offset		node%d -> node%d [label=" <" color="red"]
m:%d unique:%d final:%d rematerializable:%d
All kind of block should be processed above.stackalloc register arg %s skipping name %s
op %s doesn't have a ARM64BitField aux fieldinvalid arrangement, should be B8 or B16: %vinvalid arrangement on op Vn.<T>, Vd.<T>: %vsource register pair must be contiguous: %v
span on userArena.faultList has invalid sizesend on synctest channel from outside bubbleruntime: lfstack.push invalid packing: node=out of memory allocating heap arena metadatagcmarknewobject called while doing checkmarkruntime: cannot remap pages in address space/cpu/classes/scavenge/background:cpu-secondsruntime: unexpected metric registration for active sweepers found at start of mark phaseno P available, write barriers are forbiddenheapInUse and consistent stats are not equaltotalFree and consistent stats are not equalmappedReady and other memstats are not equalcannot trace user goroutine on its own stacktraceStartReadCPU called with trace disabledunsafe.Slice: ptr is nil and len is not zeroreflect: call of MakeFunc with non-Func typereflect: Value.SetIterKey called before Nextreflect: FieldByNameFunc of non-struct type reflect: funcLayout with interface receiver  using value obtained using unexported fieldreflect: function created by MakeFunc using reflect: slice length out of range in SetLenmult128bitPow10: power of 10 is out of rangestack object too big: %v of type %v, size %dcannot type switch on non-interface value %L:
	%v is pointer to interface, not interface%v does not implement %v (missing %v method)bad setting %q for covermode in coveragecfg:newLoc on non-canonical %v (canonical is %v)//%s is only allowed in the standard libraryunexpected path for user-defined package: %qfailed to find common type between %v and %vinvalid go:embed: multiple files for type %vRule expects a uint16 constant load. got:
%vInvalid mb or sh for RLDIC, RLDICL: %x %x
%vfailed to lookup instruction data for %v: %v%v: encoding called for a pseudo instructioncannot handle the floating point constant %vfield offset for %s at %s has been set to %dencoding alphabet contains newline characterencoding alphabet includes duplicate symbols%v: can't PGO devirtualize go/defer call %v
OCALLINTER doesn't contain SelectorExpr: %+vcannot declare in post statement of for loophexadecimal mantissa requires a 'p' exponentfirst argument to append must be a slice; %simplicitly instantiated function as argumentcannot convert %s (in %s) to type %s (in %s)invalid operation: cannot take address of %sinvalid argument: %s %s must not be negativemismatched types %s and %s (cannot infer %s)%s to %s comparable requires go1.20 or latertoo many values in struct literal of type %sduplicate index %d in array or slice literal%s already declared through dot-import of %srange over %s permits no iteration variablesembedded field type cannot be unsafe.Pointercannot use iota outside constant declarationcannot use %s in union (%s contains methods)double declaration of predeclared identifiercrypto/sha256: invalid hash state identifierreleaseReader %s: released (%d readers now)
mismatch: sample has: %d values vs. %d types%s:%d: invalid symabi: syntax is "%s sym abi"attempted to alias undefined intrinsic: %s.%sstarting block %v when block %v has not endedKeepAlive variable %v must have Addrtaken setCheckLoweredPhi called with non-phi value: %vin %s, badly placed ArgIReg or ArgFReg: %v %vzerorange count not a multiple of widthptr %dinvalid GORISCV64: must be rva20u64, rva22u64handleTransientAcquire called in invalid modehandleTransientRelease called in invalid modefinal release of handle without processStatusillegal broadcast without memory argument: %vSetByval called on non-canonical variable: %vIncorrect HasShape flag for cached slice typeexit block %s has non-memory control value %svalue %v has Aux type %T, want *AuxNameOffsetvalue %s has an AuxInt value %d but shouldn'tlive flag in %s's predecessors not consistentMark stmt new line %s %s %s %s prev pos = %s
ARM(64) bit field width constant out of rangexposmap.set(%d), file index not found in map
illegal combination: %v %v %v %v %v %v, %d %dtransitioning GC to the same state as before?produced a trigger greater than the heap goaltried to run scavenger from another goroutineruntime: failed mSpanList.remove span.npages=totalAlloc and consistent stats are not equalexitsyscall: syscall frame is no longer validunsafe.String: ptr is nil and len is not zeroHeap size target for the end of the GC cycle.reflect: OverflowComplex of non-complex type reflect: nil type passed to Type.AssignableToreflect: internal error: invalid method indexcannot send after transport endpoint shutdown=-= addregion st=%d en=%d: add part %d -> %d
invalid operation: %v (%v cannot be compared)mixture of field:value and value initializersarguments to copy must be slices; have %L, %Lfirst argument to delete must be map; have %Linvalid case %L in switch (incomparable type)autolabel prefix must start with '.', have %qbufio.Scanner: Read returned impossible countassembling DWARF inlined routine info for %v
%s: parameter %v leaks to %s with derefs=%d:
%v: can inline %v with cost %d as: %v { %v }
marked as having an escaping uintptr argumentimport path %q is reserved and cannot be usedimport path contains backslash; use slash: %qgo:embed cannot apply to var with initializercannot inline call to %v: missing inline bodyelem size not a multiple of elem align for %vextra requested of type with no extra info %vConstant 0x%x (%d) is not a multiple of 16
%vdo not know how to handle %v without TYPE_MEMcannot CLEAR %d bytes, must be greater than 0math/big: cannot unmarshal %q into a *big.Intmath/big: cannot unmarshal %q into a *big.Ratimports must appear before other declarationscannot parenthesize type in composite literalinterface method must have no type parametersvar declaration not allowed in %s initializerinvalid argument: length and capacity swappedpartially instantiated function in assignmentunknown field %s in struct literal of type %simported type with unresolved underlying typecan only use ... with final parameter in listbreak not in for, switch, or select statementcannot use %s in union (%s embeds comparable)corrupt: limit %d is within mapping length %dInvertFlags should never make it to codegen %vdeferprocStack with non-zero stack size %d: %vinvalid GOMIPS64: must be hardfloat, softfloathandlePersistentRelease called in invalid modeneither $XDG_CONFIG_HOME nor $HOME are definedmissing frame pointer instruction: MOVQ SP, BPdefer block %s has non-memory control value %snilcheck must have argument of pointer type %sgenerating -N reg param loc lists for func %q
SSAable array must have no more than 1 elementloop finding    succ %s of %s is IRRED, in %s
starting merge block %s with end state of %s:
stackalloc PPARAM name %s skipping non-Arg %s
arg of result selector %s is not a results: %snegative frame size %d - did you mean NOFRAME?slice bounds out of range [:%x] with length %ypanicwrap: unexpected string after type name: memory reservation exceeds address space limittried to park scavenger from another goroutinereleased less than one physical page of memorysysGrow bounds not aligned to pallocChunkBytesruntime: failed to create new OS thread (have runtime: panic before malloc heap initialized
stopTheWorld: not stopped (status != _Pgcstop)select on synctest channel from outside bubbleruntime: name offset base pointer out of rangeruntime: type offset base pointer out of rangeruntime: text offset base pointer out of rangereflect: Value.SetIterValue called before Nextreflect: nil type passed to Type.ConvertibleToreflect.Struct: fields with different PkgPath reflect.StructOf: illegal embedded field type  returned value obtained from unexported fieldreflect: slice capacity out of range in SetCapreflect.Value.Slice: slice index out of boundsbytes.Reader.UnreadByte: at beginning of slicebytes.Reader.UnreadRune: at beginning of sliceboth Setctty and Foreground set in SysProcAttrTime.UnmarshalJSON: input is not a JSON string=-= evicting %q due to pendingUse %d count %d
ascompatet: assignment count mismatch: %d = %dOCONVIFACE can't operate on an empty interfaceFuncPC intrinsic should return uintptr, got %vinvalid operation %v (3-index slice of string)LookupCoverage: can't find runtime/coverage.%scan't find inlIndex %d in imap for prog at %d
marked as having a keep-alive uintptr argumentusage: //go:wasmimport importmodule importnamecollision: types %v and %v have link string %qfirst path segment in URL cannot contain coloninvalid mask for rotate: %x (end != bit 63)
%vsecond argument must be an even register in %voutput argument must be an even register in %vmath/big: mismatched montgomery number lengthsinvariant failed: growthLeft is unexpectedly 0%v: PGO devirtualizing function call %v to %v
%v: call %s:%d: hottest callee %s (weight %d)
else must be followed by if or statement blockinvalid argument: cannot make %s: no core typeinvalid argument: %s is not a boolean constantinvalid operation: cannot close non-channel %simplicitly instantiated function in assignmentinvalid operation: cannot call non-function %s## cycle detected: objPath = %s->%s (len = %d)cannot use generic %s %s without instantiationtype %s is pointer to interface, not interface(wrong type for method %s)
		have %s
		want %sparameterized receiver contains nil parameterscannot define new methods on non-local type %sinvalid use of ~ (underlying type of %s is %s)corrupt: failed to write entry: %#x+%d vs %#x
MOVO for non zero constants not implemented: %sIncorrect HasShape flag for cached pointer typecannot read sources for inlined function %v: %vin %s, badly placed LoweredGetClosurePtr: %v %vGOEXPERIMENT regabiargs requires regabiwrappersunexpected error wrapping poll.ErrFileClosing: conflicting package names %s and %s for path %qretjmp block %s has non-memory control value %sat %v: load with unexpected source op: %v (%v)
at %v: unexpected spill of unnamed register %s
a0 should not be nil, a=%v, container=%v, at=%v		node%d -> node%d [label=" <=" color="green"]
newStackAllocState called without previous freearm ops not initialized, call arm.buildop firstframe size %d not 0 or a positive multiple of 4note: flush literal pool at %#x: len=%d ref=%x
taking address of TLS variable is not supportedregister element index out of range 0 to %d: %vslice bounds out of range [::%x] with length %yreceive on synctest channel from outside bubbleruntime·lock: sleeping while lock is availableP has cached GC work at end of mark terminationfailed to acquire lock to start a GC transitionfinishGCTransition called without starting one?tried to sleep scavenger from another goroutineheapReleased and consistent stats are not equalracy sudog adjustment due to parking on channelfunction symbol table not sorted by PC offset: attempted to trace a bad status for a goroutinereflect.Value.Bytes of unaddressable byte arrayreflect: CallSlice with too few input argumentsregister-based return value has stack componentreflect.Value.Slice3: slice index out of boundsreflect.Value.UnsafeAddr of unaddressable valueattempting to link in too many shared librariescan't find Phi before write barrier end mark %varguments of comparison must be lvalues - %v %vunknown field '%v' in struct literal of type %vfirst argument to append must be slice; have %Lfirst argument to copy should be slice; have %Lmultiple nil cases in type switch (first at %v)cannot assign %v to %L in multiple assignment%sbufio: reader returned negative count from ReadcreateSimpleVar unexpected class %v for node %vfunction too complex: cost %d exceeds budget %d%v: skip inlining within testing.B.loop for %v
import path contains invalid UTF-8 sequence: %qimport path contains invalid character '%c': %qunexpected blank symbol in interface method setdwarf: unsupported attribute form %d / class %dUnexpected alignment: %d for PCALIGN directive
preprocessed profile entry got %v want 2 fields%v: PGO devirtualizing interface call %v to %v
pkgbits: readUvarint overflows a 64-bit integernon-declaration statement outside function bodyinstantiated ident not found; please report: %sinvalid argument: index %s out of bounds [0:%d]%s type arguments for type %s: have %d, want %dinvalid operation: %s%s%s (non-numeric type %s)Pseudo-op should not make it to codegen: %s ###
memory no longer live from 2-result dottype loadinvalid GOPPC64: must be power8, power9, power10unknown TLS base register for linux with -sharededge [fontsize=16,fontname="Menlo,Times,serif"];store order is wrong: there are stores before %vschedule does not include all values in block %s%v: unaligned frame size %d - must be 16 alignedslice bounds out of range [:%x] with capacity %yruntime: cannot map pages in arena address spaceruntime: malformed profBuf buffer - invalid sizeattempt to trace invalid or unsupported P statusreflect: CallSlice with too many input argumentsstrconv: illegal AppendFloat/FormatFloat bitSizenot enough significant bits after mult64bitPow10k=%q v=+%v slpos %d vslot %d out of range of m.vbvget: index %d is out of bounds with length %d
%v undefined (type %v has no field or method %v)select case must be receive, send or assign recvinvalid operation: %v (send to non-chan type %v)bufio: writer returned negative count from Writego:nosplit and go:systemstack cannot be combineddivision of zero by zero or infinity by infinityInt.GobDecode: encoding version %d not supportedRat.GobDecode: encoding version %d not supportedbvset: index %d is out of bounds with length %d
preprocessed profile contains duplicate edge %+vinvalid operation: operator %s not defined on %scannot use FakeImportC and go115UsesCgo togetherreceiver type parameter %s must be an identifierinvalid operation: cannot send to non-channel %scannot use generic type %s without instantiationAddTupleFirst* should never make it to codegen %v// generated by compile -asmhdr from package %s

cgo exported function %v cannot have ABI wrappers%.5d <span class="l%v line-number">(%s)</span> %sspill/restore type %s doesn't fit in slot type %sdirectly calling duff when dynamically linking Goheap-allocated closure %s, not allowed in runtimetwo final stores - simultaneous live stores %s %sat %v: unexpected arg op on already-live slot %v
destination register pair must be contiguous: %v
slice bounds out of range [::%x] with capacity %yinvalid memory address or nil pointer dereferencepanicwrap: unexpected string after package name: s.allocCount != s.nelems && freeIndex == s.nelemsruntime.reflect_makemap: unsupported map key typesweeper left outstanding across sweep generationsfully empty unfreed span set block found in resetcasgstatus: waiting for Gwaiting but is GrunnableThe total amount of heap space that is scannable.reflect.Value.Slice: slice of unaddressable arraystrings.Reader.UnreadByte: at beginning of stringstrings.Reader.UnreadRune: at beginning of stringstrings.Reader.WriteTo: invalid WriteString countnot enough significant bits after mult128bitPow10invalid or incomplete multibyte or wide charactertwo vars live at pointerMap generation: %q and %qclosure type does not match order's assigned typemissing slice argument to copy for OMAKESLICECOPYassignment mismatch: %d variable%s but %v value%sinvalid ir.Name on debugInfo.RegOutputParams listhot-node enabled increased budget=%v for func=%v
call to runtime function %s in instrumented buildincomplete (or unallocatable) map key not allowedalias type %v has object %v, but %v has object %vmips ops not initialized, call mips.buildop firstinvalid offset for %v: %d is not a multiple of %ddisplacement must be in range [0, 4096) to use %v%v: edge %s:%d -> %s (weight %d): hottest so far
invalid argument: %s is not a selector expression## cycle contains: %d values, %d type definitionsinvalid cycle in declaration: %s refers to itselfinvalid operation: shift count %s must be integertype %s of %s does not match %s (cannot infer %s)list contains both named and anonymous parameterscannot define new methods on instantiated type %scannot use type switch on type parameter value %srange over %s permits only one iteration variableinternal error: fillWindow called with stale datasetting branch target when type is not TYPE_BRANCHresult and addend are not in the same register: %vFlagConstant op should never make it to codegen %vGCAdjust: Regret unexpected KindBad for metric %s
argument is TYPE_CONST, should be TYPE_ADDR, in %vargument is TYPE_ADDR, should be TYPE_CONST, in %vProcessing %v, block changed %v, initial state:
%v%v: bad type for offset %d (should be add/sub+ldp)%v: bad type for offset %d (should be add/sub+stp)mallocgc called with gcphase == _GCmarkterminationruntime.Pinner: object was allocated into an arenaruntime.Pinner: decreased non-existing pin counterrecursive call during initialization - linker skewattempt to execute system stack code on user stackreflect.Value.Slice3: slice of unaddressable arrayInvalidClearTypeTooLargeInvalidMinMaxOperandTooNewNewBulk too big: nbit=%d count=%d nword=%d size=%drange start not ordered %d:%d less than prev %d:%daddIndirectEdges: %s not found in export data: %v
MakeFromLiteral called with non-zero last argumentinvalid operation: %v (mismatched types %v and %v)loop variable %v now per-iteration, heap-allocatedmismatched import path, have %q (%p), want %q (%p)encodingRelocHeader already true; recursive flush?%v: expected no register in %s but got register %sencodeR: instruction uses rs2, but rs2 was nonzerounsupported immediate instruction %v for splittingFloat.GobDecode: encoding version %d not supportedbvunset: index %d is out of bounds with length %d
invalid operation: %v (mismatched types %s and %s)invalid operation: %s (mismatched types %s and %s)goto %s jumps over variable declaration at line %dvariadic function must have at least one parametercannot define new methods on generic alias type %sinvalid operation: cannot send to %s: no core typerefresh %s: locked havePtr=%v readers=%d extra=%d
weird unsigned integer to float conversion %v -> %vweird float to unsigned integer conversion %v -> %v<dt class="ssa-prog-src"></dt><dd class="ssa-prog">x86 tables not initialized, call x86.instinit firstinvalid value %q for -lang: max known version is %qinternal error: DwarfAbstractFunc double process %vvalue %v has an AuxInt value that is a valid opcodearm64 ops not initialized, call arm64.buildop firstrounded up to a value that is not a power of 2: %d
invalid register numbers in ARM64 register list: %vlimiterEvent.stop: invalid limiter event type foundpotentially overlapping in-use allocations detectedfatal: systemstack called from unexpected goroutineJSON decoder out of sync - data changing underfoot?variable %v both output param and heap output paramaddIndirectEdges: %s attempting export data lookup
duplicate nil case not detected during typechecking%v undefined (type %v is interface with no methods)invalid operation %v (slice of unaddressable value)bad setting %q for covergranularity in coveragecfg:%v capturing by %s: %v (addr=%v assign=%v width=%d)loop variable %v now per-iteration, stack-allocatedincomplete (or unallocatable) map value not allowedinvalid go:embed: build system did not map file: %sppc64 ops not initialized, call ppc64.buildop firstunexpected register setting for branch with CR: %d
s390x ops not initialized, call s390x.buildop firstcannot represent parameters of type %v in registersgodebug: Value of name not listed in godebugs.All: preprocessed profile error processing call line: %wCallSiteInLoopCallSiteOnPanicPathCallSiteInInitFuncgot %d type arguments but %s has %d type parameters%s mentions %s, but %s is not in the type set of %scannot import package as init - init must be a funcfunc %s must have no arguments and no return valuesimplementation of alignof returned an alignment < 1mask register must not be K0 for .Z instructions: %vwasmimport aux sym must exist and have non-zero sizeEarly out, no predecessors changed since last check
at %v: slot %v in register %v with no location entryMemories %s, %s, and %s should all be equal after %s<td id="%v-col" class="collapsed"><div>%v</div></td>Induction variable: limits %v%v,%v%v, increment %d%scan not break addition/subtraction when S bit is setruntime: cannot disable permissions in address spaceruntime.SetFinalizer: pointer not in allocated blockruntime: use of FixAlloc_Alloc before FixAlloc_Init
span set block with unpopped elements found in resetcasfrom_Gscanstatus: gp->status is not in scan stateThe number of non-default behaviors executed by the merge method invoked on non-overlapping/non-adjacentinvalid operation: %v (send to receive-only type %v)expected signature without parameters or results: %vexpected $$ marker, but found %q (recompile package)runtime assumes elemOff for 8-byte keys is 8, got %dmath/big: cannot unmarshal %q into a *big.Float (%v)// for more information on the format of this file.
PGO devirtualizing function call to %+v. After: %+v
cannot use ~ outside of interface or type constraintinvalid operation: %s (slice of unaddressable value)inferred type %s for %s does not match type %s of %stype %s of %s does not match inferred type %s for %sConfig.Importer.Import(%s) returned nil but no errorfunction with type parameters cannot have a receiverrange clause permits at most two iteration variablesundefined array length %s or missing type constraintunexpected object with %v implicit type parameter(s)block pred/succ not crosslinked correctly %d:%s %d:%sblock succ/pred not crosslinked correctly %d:%s %d:%sSaw double use of wide SelectN %s operand of Store %sExpected container OpArg or OpSelectN, saw %v insteadNOFRAME functions must have a frame size of 0, not %dnon-concurrent sweep failed to drain all sweep queuesexited a goroutine internally locked to the OS threadreflect: non-interface type passed to Type.Implementsreflect.Value.Slice: string slice index out of bounds  =-= overlap of %d[%v] {%s} with %d[%v] {%s} is: %v
phi before write barrier end mark has %d args, want 2an error occurred when processing type switch case %vinvalid operation: %v (operator %v not defined on %s)invalid operation: %v (receive from non-chan type %v)duplicate case %v in type switch
	previous case at %s:
	%v is incomplete (or unallocatable), but %v is notbufio.Scan: too many empty tokens without progressingimport %q while compiling that package (import cycle)go:embed only allowed in Go files that import "embed"%v has %v+%v params, but instantiated with %v+%v argsruntime assumes elemOff for string keys is %d, got %dmath/big: internal error: cannot find (D/n) = -1 for small map with no empty slot (concurrent map writes?)preprocessed profile malformed header; got %q want %qpreprocessed profile error processing call weight: %wPGO devirtualizing interface call to %+v. After: %+v
conversion of slice to array requires go1.20 or laterinvalid operation: cannot receive from non-channel %sinvalid operation: shifted operand %s must be integercompile: version %q does not match go tool version %q
index and destination registers should be distinct: %vinvalid use of LSym - NewVarInfo with Extra of type %Tvardef must be merge candidate or have pointer type %sMark stmt end of block differs %s %s %s prev pos = %s
illegal combination %v; %v %v %v; from %d %d; to %d %d%d is too large for a scaled 24 bit unsigned immediateruntime.m memory alignment too small for spinbit mutexmin size of malloc header is not a size class boundarycasGToWaitingForGC with non-isWaitingForGC wait reasonno goroutines (main called runtime.Goexit) - deadlock!trace: non-empty full trace buffer for done generationtrace: non-empty full trace buffer for next generation	goroutine running on other thread; stack unavailable
panic calling String method on zero %v for flag %s: %vreflect: Value.SetIterKey called on exhausted iteratorbytes.Buffer: reader returned negative count from Readk=%s v=+%v slpos %d vslot %d Leader(%q) got %v want %vload of write barrier flag not from correct global: %s"%v" [color=black, style=%s, label="%v,inl_cost=%d"];
partial call type does not match order's assigned typeinvalid operation: %v (receive from send-only type %v)first argument to unsafe.String must be *byte; have %Lselect assignment must have receive on right hand sidemissing linker fingerprint in exportdata, but found %qchan of incomplete (or unallocatable) type not allowedinvalid go:embed: build system did not map pattern: %sdo not know how to handle TYPE_ADDR in %v with -sharedinstruction missing from switch in asm9.go:buildop: %vmaymorestack with -shared or -dynlink is not supportedbinary.Write: some values are not fixed-sized in type %v: edge %s:%d -> %s (weight %d): callee not a method
%v: edge %s:%d -> %s (weight %d): %v doesn't match %v
invalid operation: invalid use of ... with built-in %scannot use a type parameter as RHS in type declarationtype %s has no field or method %s, but does have %s %sBUG: Open called with inconsistent values for 'rotate'%s:%d: invalid importmap: syntax is "importmap old=new"stack frame too large (>1GB): %d MB locals + %d MB argsinstrument2: non-nil addr2 for non-move instrumentationos: invalid use of WriteAt on file opened with O_APPENDmask register must be specified for .Z instructions: %vPxxxPEXTERNPAUTOPAUTOHEAPPPARAMPPARAMOUTPTYPEPARAMPFUNCinvalid use of LSym - NewFuncInfo with Extra of type %Tinvalid use of LSym - NewFileInfo with Extra of type %Tinvalid use of LSym - NewTypeInfo with Extra of type %T		node%d [label=<%s <font point-size="6">[%d]</font>>]
resultInArg0 value's input %v cannot be an output of %sdo not know how to handle TYPE_ADDR in %v with -dynlinksource register pair must start from even register: %v
mheap.freeSpanLocked - invalid free of user arena chunkcasfrom_Gscanstatus:top gp->status is not in scan stateCount of completed GC cycles forced by the application.reflect: internal error: invalid use of makeMethodValuereflect.FuncOf: last arg of variadic func must be sliceinternal error: apparent multiple defs for SSA value %d=+= at instr %d v%d indirect upwards-exposed use of %v
duplicate default case not detected during typecheckinginvalid operation: %v (map can only be compared to nil)invalid operation: %v (argument must be a map or slice)first argument to unsafe.Slice must be pointer; have %Lbufio.Scanner: SplitFunc returns negative advance count%v: cannot inline %v into %v: repeated recursive cycle
invalid library name %q in cgo_import_dynamic directiveloong64 ops not initialized, call loong64.buildop firstsigned immediate %d must be in range [%d, %d] (%d bits)Float.GobDecode: buffer too small for finite form floatinvalid operation: cannot close receive-only channel %sinvalid operation: cannot slice %s: %s has no core typeembedded field type cannot be a pointer to an interfaceFunction address for %v should be in R12 %d but is in %dexpected count fit to a uintptr size, have: %d, want: %dstrings: illegal use of non-zero Builder copied by valueinternal/abi.FuncPC%s expects an interface value, got %vlikeliness prediction %d for block %s with %d successorsphi length %s does not match pred length %d for block %stotalBeforeMax (%d) != copyTo (%d), max_b=%v, b=%v, c=%vprofilealloc called without a P or outside bootstrappingin gcMark expecting to see gcphase as _GCmarkterminationruntime: netpoll: eventfd ready for something unexpectedCount of calls made from Go to C by the current process.ptrEncoder.encode should have emptied ptrSeen via defersnon-empty pointer map passed for non-pointer-size valuesreflect: Value.SetIterValue called on exhausted iteratork=%s v=+%v val slice used violation at slpos %d vslot %ddotdotdot base type does not match order's assigned typeinvalid operation: %v (func can only be compared to nil)invalid case %v in switch (mismatched types %v and bool)invalid method expression %v.%v (needs pointer receiver)invalid PGOInlineCDFThreshold, must be between 0 and 100call to into "no-race" package function %s in race buildexpect mixed interface and non-interface, have %L and %Lout array in span0 is too small, need at least %d for %vout array in span9 is too small, need at least %d for %vUnable convert TOC-relative relocation %v to PC-relativeillegal system call; system call number out of range: %vwrapper functions for WASM export should not have a body%v: edge %s:%d -> %s (weight %d): too cold (hottest %d)
internal error: value of %s should be a boolean constant## cycle contains: generic type in a type parameter listgeneric type alias requires GOEXPERIMENT=aliastypeparamsinvalid operation: cannot receive from %s (no core type)type %s is pointer to type parameter, not type parameterreceiver declares %s, but receiver base type declares %dinvalid use of [...] array (outside a composite literal)We require the multiplcand to be stored in R3 for MLGR %svalue %v has an AuxInt value that is not an exact float32Did not find a flag matching %s in -d=ssa/%s debug optionPruned b%d, lastChanged was %d but b%d lastChecked is %d
%v [label="%v%s\n%v",id="graph_node_%v_%v",tooltip="%v"];runtime: checkmarks found unexpected unmarked object obj=runtime: failed to disable profiling timer; timer_delete(non-Go code set up signal handler without SA_ONSTACK flagCount of completed GC cycles generated by the Go runtime.sync: WaitGroup misuse: Add called concurrently with Waitinvalid operation: %v (slice can only be compared to nil)cannot use promoted field %v in struct literal of type %vinvalid operation: %v (type %v does not support indexing)invalid operation: %v (cannot close receive-only channel)arguments to copy have different element types: %L and %Linvalid case %v in switch (can only compare %s %v to nil)%v does not implement %v (%v method has pointer receiver)usage: //go:cgo_import_dynamic local [remote ["library"]]//go:linkname must refer to declared function or variableinvalid mask for shift: %016x (mb=%d,me=%d) (shift %d)
%vwrapper functions for WASM imports should not have a bodycannot run executable found relative to current directory (set GODEBUG=execwait=2 to capture stacks for debugging)invalid operation: %s %s= %s (mismatched types %s and %s)invalid operation: cannot send to receive-only channel %scrypto/drbg: internal error: request size exceeds maximumGenWasmExportWrapper call not supported on %s: func was %vCould not create file %s for logging optimizer actions, %vLoweredGetClosurePtr appeared outside of entry block, b=%sfunc %s, startMem[%v] has different values, old %v, new %v%v: doesn't support BL offset(REG) with non-zero offset %dNumber of objects, live or unswept, occupying heap memory.json: cannot set embedded pointer to unexported struct: %vcalled CompareAndSwap when value is not of comparable typewrite barrier control value has more than one argument: %simplicit assignment of unexported field '%s' in %v literalinvalid type assertion: %v (non-interface type %v on left)second argument to copy should be slice or string; have %Lnon-monotonic scope positions
	%v: previous scope positionwriting section %v at offset %v, but it should be at %v*%v//go:linkname reference of an instantiation is not allowedcannot handle NAME_EXTERN on both sides in %v with -sharedInvalid addressing mode used in index type instruction: %vsigned immediate %#x must be in range [%#x, %#x] (%d bits)function parameter has no ABI-defined frame-pointer offsetGODEBUG=execwait=2 detected a leaked exec.Cmd created by:
callee %s is a closure (runtime.memhash_varlen), skipping
cannot use generic function %s without instantiation in %sinvalid operation: %v expects %d or %d arguments; found %dinvalid argument: field %s is embedded via a pointer in %sinvalid argument: maps of %s must have identical key typesimpossible type assertion: %s
	%s does not implement %s %sassignment operation %s requires single-valued expressionsmakeABIWrapper support for wrapping methods not implementedunknown TLS base location for linux/freebsd without -sharedcannot handle NAME_EXTERN on both sides in %v with -dynlinkDid not find a phase matching %s in -d=ssa/... debug optionBuildFuncDebug on func %v that has not been fully processedloop finding    succ %s of %s provides loop with header %s
found induction variable %v (inc = %v, min = %v, max = %v)
storeOrder: value is missing, total count = %d, values = %vcannot use same register as both source and destination: %vruntime: mmap: too much locked memory (check 'ulimit -l').
tried to trace goroutine with invalid or unsupported statusreflect: reflect.Value.Elem on an invalid notinheap pointerreflect: indirection through nil pointer to embedded structsync: WaitGroup is reused before previous Wait has returnedbufio.Scanner: SplitFunc returns advance count beyond input//go:linkname only allowed in Go files that import "unsafe"internal/runtime/maps.Map size not correct: got %d, want %dCALL can only be used on toplevel, try CALLNORESUME insteadEnableAlias set while !EnableAlias type checking is ongoing!EnableAlias set while EnableAlias type checking is ongoinggeneric type alias requires GODEBUG=gotypesalias=1 or unsetinvalid operation: cannot receive from send-only channel %smixture of field:value and value elements in struct literalfunction with receiver type parameters must have a receiverfunc must be func(yield func(...) bool): unexpected results %d: %q isleader=%v subsumed=%v used=%v sz=%d align=%d t=%s
%s: symbol %s redeclared
	%s: other declaration of symbol %sblock %s not in loop branches to non-header block %s in loopedge[constraint=false,color=gray,style=solid,arrowhead=dot];destination register pair must start from even register: %v
manual span allocation called with non-manually-managed typeaddr range base and limit are not in the same memory segmentruntime: failed to configure profiling timer; timer_settime(runtime: malformed profBuf buffer - tag and data out of syncThe total amount of global variable space that is scannable.called CompareAndDelete when value is not of comparable typereflect: call of reflect.Value.Cap on ptr to non-array Valuereflect: call of reflect.Value.Len on ptr to non-array Valuebytes.Reader.UnreadRune: previous operation was not ReadRunek=%s v=+%v follower %s size %d larger than leader %s size %dinvalid operation: %v (shift count type %v, must be integer)%v undefined (cannot refer to unexported field or method %v)assignment mismatch: %d variable%s but %v returns %d value%sinvalid case %v in switch on %v (mismatched types %v and %v)%v does not implement %v (%v method is marked 'nointerface')loop variable %v now per-iteration (loop inlined into %s:%d)internal/runtime/maps.Iter size not correct: got %d, want %dUnexpected Instruction operand index %d offset %d class %d 
// DO NOT EDIT (use 'go test -v -update-expected' instead.)
Empty hash match string for %s should be first (and only) oneCreateWasmImportWrapper call not supported on %s: func was %vmask, index, and destination registers should be distinct: %v%v -> %v [label=" %d ",style="%s",color="%s",arrowhead="%s"];Mark stmt differing-pred %s %s %s %s, different=%s ending %s
runtime: may need to increase max user processes (ulimit -u)
Cumulative sum of heap memory freed by the garbage collector.The number of bytes of stack that were scanned last GC cycle.Memory that is reserved for or used to hold runtime metadata.reflect: wrong return count from function created by MakeFunck=%s v=+%v follower %s hasptr=true but leader %s hasptr=falsemapKeyTemp: key type is not sufficiently aligned, kt=%v nt=%v%v undefined (type %v is pointer to interface, not interface)arguments to copy have different element types: %L and stringcannot switch on %L (struct containing %v cannot be compared)unsuitable %s %q mentioned in coveragecfg, improper type '%v'call to into runtime package function %s in -d=checkptr buildcan only use //go:noescape with external func implementationsinternal/runtime/maps.table size not correct: got %d, want %dCR argument must be a conditional register field (CR0-CR7)
%vAUIPC needing PC-relative reloc missing following instructionexec: Cmd started a Process but leaked without a call to Waitinvalid argument: argument has type %s, expected complex typeconversion of slice to array pointer requires go1.17 or laterfunc must be func(yield func(...) bool): wrong argument countfunc must be func(yield func(...) bool): argument is not funcembedded field type cannot be a (pointer to a) type parameterfound bad pointer in Go heap (incorrect use of unsafe or cgo?)limiterEvent.stop: found wrong event in p's limiter event slotslice length too short to convert to array or pointer to arrayruntime: internal error: misuse of lockOSThread/unlockOSThreadreflect.ArrayOf: array size would exceed virtual address spacereflect: reflect.Value.Pointer on an invalid notinheap pointerstrings.Reader.UnreadRune: previous operation was not ReadRuneinterval construct error for var %q in func %q (%d instrs): %vfirst argument to append must be typed slice; have untyped nilunsafe.Slice of incomplete (or unallocatable) type not alloweddebuginfo unused node (AllocFrame should truncate fn.Func.Dcl)%s loop ending at %d:%d was modified (loop inlined into %s:%d)do not know how to handle LEAQ-type insn to non-register in %v%v: immediate %d in raw position cannot be larger than 32 bits0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%v: edge %s:%d -> %s (weight %d) (missing IR): hottest so far
invalid operation: %s arguments for %v (expected %d, found %d)select case must be send or receive (possibly with assignment)Could not create directory %s for logging optimizer actions, %vbad visitOrder, no predecessor of %s has been visited before itmalformed GOMEMLIMIT; see `go doc runtime/debug.SetMemoryLimit`internal/sync.HashTrieMap: ran out of hash bits while iteratinginternal/sync.HashTrieMap: ran out of hash bits while insertingk=%s v=+%v follower %s align %d greater than leader %s align %dall pointer-containing defer arg slots should have Needzero setinvalid operation: %v (struct containing %v cannot be compared)can only use //go:wasmimport with external func implementationsassemble: instruction with branch-like opcode lacks destination%v: edge %s:%d -> %s (weight %d): %v doesn't implement %v (%s)
%v: edge %s:%d -> %s (weight %d): callee is a different method
invalid operation: shifted operand %s (type %s) must be integerinvalid argument: copy expects slice arguments; found %s and %sunknown field %s in struct literal of type %s, but does have %sinvalid use of ListExpr for index expression %v with %d indicesConfig.Importer.ImportFrom(%s, %s, 0) returned nil but no error%v: function %v considered 'big'; reducing max cost of inlinees
 %d: %q frameoff %d isleader=%v subsumed=%v sz=%d align=%d t=%s
cannot take offset of nil, blank name or non-global variable: %vruntime.SetFinalizer: first argument was allocated into an arenaattempted to trace stack of a goroutine this thread does not ownDeprecated. Prefer the identical /sched/pauses/total/gc:seconds.json: invalid number literal, trying to unmarshal %q into Numberreflect.StructOf: struct size would exceed virtual address space0000000000000000000000000000000000000000000000000000000000000000																																																																malformed prefix %q: escape sequence must contain two hex digitsk=%s v=+%v slpos 0 vslot %d IsLeader(%q) is false should be true%v can't be allocated in Go; it is incomplete (or unallocatable)impossible type switch case: %L cannot have dynamic type %v (%s)calling method %v with receiver %L requires explicit dereference%v is incomplete (or unallocatable); stack allocation disallowedusage: //go:cgo_import_dynamic local [remote ["lib.a/object.o"]]export data desync: package %q, section %v, index %v, offset %v
Constant(%d) must within the range of [-512,-8] in steps of 8
%vpreprocess: found symbol that does not start with TEXT directiveABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789-_# Score  Adjustment  Status  Callee  CallerPos Flags ScoreFlags
package requires newer Go version %v (application built with %v)cannot refer to unexported field %s in struct literal of type %sinvalid operation: pointers of %s must have identical base typesimplementation of offsetsof returned the wrong number of offsetsflate: invalid compression level %d: want value in range [-2, 9]%s:%d: invalid packagefile: syntax is "packagefile path=filename"location lists requested but register mapping not available on %vinternal/abi.FuncPC%s expects an %v function, %s is defined as %vinconsistent state for %v, num predecessors: %d, num phi args: %dCannot disable required SSA phase %s using -d=ssa/%s debug optiontried to assign register %d to %s/%s but it is already used by %suser arena chunk size is not a multiple of the physical page sizeruntime.SetFinalizer: pointer not at beginning of allocated blockreflect: StructOf does not support methods of embedded interfacesk=%s v=+%v slpos %d vslot %d Subsumed(%q) is false should be trueinvalid go:embed: build system did not supply embed configurationinvalid argument: arguments have type %s, expected floating-pointinvalid method expression %s.%s (needs pointer receiver (*%s).%s)type %s has no field or method %s, but does have unexported %s %sold textual export format no longer supported (recompile package)internal error: DwarfFixupTable.SetPrecursorFunc double call on %vadded block target for h=%v, b=%v, x=%v, y=%v, tgt.v=%s, tgt.i=%d
%v: bad type for offset %d (should be 9 bit signed immediate load)runtime: unexpected error while checking standard file descriptor runtime: ReadTrace called from multiple goroutines simultaneously
Cumulative sum of memory allocated to the heap by the application.reflect: indirection through nil pointer to embedded struct field unknown field '%v' in struct literal of type %v (but does have %v)cannot refer to unexported field '%v' in struct literal of type %v%v undefined (type %v has no field or method %v, but does have %v)// callsite: %s flagstr %q flagval %d score %d mask %d maskstr %q
impossible type switch case: %s
	%s cannot have dynamic type %s %scannot handle more than %d union terms (implementation limitation)binary export format %q is no longer supported (recompile package)%v: bad type for offset %d (should be 9 bit signed immediate store)Memory that is used by the stack trace hash map used for profiling.usage: -d arg[,arg]* and arg is <key>[=<value>]

<key> is one of:

malformed prefix %q: escape sequence %q must contain two hex digitsphi arg at different location than phi: %v @ %s, but arg %v @ %s
%s
internal error: RegisterChildDIEOffsets vars/offsets length mismatchunCached value %s not found in cache, auxInt=0x%x, adjusted aux=0x%xAllThreadsSyscall6 results differ between threads; runtime corruptedreflect: reflect.Value.UnsafePointer on an invalid notinheap pointer%v does not implement %v (missing %v method)
		have %v%S
		want %v%Scannot use incomplete (or unallocatable) type as a type argument: %v	[stack trace unavailable; recompile package %q with -d=syncframes]
big: invalid 2nd argument to Int.Jacobi: need odd integer but got %scannot assign to %s (neither addressable nor a map index expression)crypto/hmac: hash generation function does not produce unique valuesinternal error: DwarfFixupTable.Finalize call during parallel backend%v: bad type for offset %d (should be 12 bit unsigned immediate load)runtime.Pinner: found leaking pinned pointer; forgot to call Unpin()?Memory that is reserved for runtime mspan structures, but not in-use.reflect: embedded interface with unexported method(s) not implementedgo:embed requires go1.16 or later (-lang was set to %s; check go.mod)// See cmd/compile/internal/inline/inlheur/testdata/props/README.txt
invalid argument: cannot make %s; type must be slice, map, or channelstack frame too large (>1GB): %d MB locals + %d MB args + %d MB calleeadded phi target for h=%v, b=%v, s=%v, x=%v, y=%v, tgt.v=%s, tgt.i=%d
%v: bad type for offset %d (should be 12 bit unsigned immediate store)Memory that is reserved for runtime mcache structures, but not in-use.debug.%s has invalid type %v (must be int, string, or *bisect.Matcher)bytes.Buffer: UnreadByte: previous operation was not a successful readToNearestEvenToNearestAwayToZeroAwayFromZeroToNegativeInfToPositiveInfGCAdjust: AtExit goal %d gogc %d count %d maxprocs %d gcConcurrency %d
unexpected frame offset for open-coded defer slot #%v: have %v, want %vunsupported setting GO386=387. Consider using GO386=softfloat instead.
invalid GOFIPS140: must be off, latest, inprocess, certified, or vX.Y.Zone or more instructions used as inline markers are no longer reachableblock %s in loop branches to non-header block %s in non-containing loopjson: invalid use of ,string struct tag, trying to unmarshal %q into %vinvalid operation: %v (arguments have type %v, expected floating-point)** malformed inlined routine range in %s: caller %s callee %s II=%d %s
unexpected instruction: expecting BGT, BEQ, BNE, BLE, BGE, BVS, BVC 
%vtoo many concurrent operations on a single file or socket (max 1048575)exec: command with a non-nil Cancel was not created with CommandContextinvalid operation: cannot use type assertion on type parameter value %simplicit assignment to unexported field %s in struct literal of type %sinvalid use of type alias %s in recursive type (see go.dev/issue/50729)internal error: DwarfFixupTable.Finalize orphan abstract function for %vruntime.Goexit called in a thread that was not created by the Go runtimereflect: embedded type with methods not implemented for non-pointer typefunc must be func(yield func(...) bool): yield func does not return bool%s: FUNCDATA use of go_args_stackmap(SB) without FUNCDATA_ArgsPointerMapsHeap memory occupied by live objects that were marked by the previous GC.The total amount space that is scannable. Sum of all metrics in /gc/scan.internal error: collision during call site table merge, fn=%s callsite=%sinternal error: AbsFuncDwarfSym requested for %v, not seen during inlining-%s option should be '<version>,<destination>' where <version> is a numberruntime: cannot set cpu profile rate until previous profile has finished.
bytes.Buffer: UnreadRune: previous operation was not a successful ReadRuneunknown field %s in struct literal of type %s, but does have unexported %scrypto/rand: failed to read random data (see https://go.dev/issue/66821): GCAdjust: Reuse GOGC adjust, current goal %d, count is %d, current gogc %d
do not know how to handle LEA-type insn to non-register in %v with -dynlinkinternal/abi.FuncPC%s does not accept func expression, which is ABIInternal%v does not implement %v (wrong type for %v method)
		have %v%S
		want %v%Sdo not know how to handle LEAQ-type insn to non-register in %v with -sharedfunc must be func(yield func(...) bool): yield func has too many parametersPlease file a bug report including a short program that triggers the error.
do not know how to handle LEAQ-type insn to non-register in %v with -dynlinkhot-budget check allows inlining for call %s (cost %d) at %v in function %s
loop variable %v now per-iteration, heap-allocated (loop inlined into %s:%d)MapIter.Next called on an iterator that does not have an associated map Valueloop variable %v now per-iteration, stack-allocated (loop inlined into %s:%d)invalid argument: mismatched types %s (previous argument) and %s (type of %s)PCALIGNMAX 'amount' %d must be non-negative and smaller than the alignment %d
Function %v, block %s with no predecessors is not first block, has previous %sreflect: embedded type with methods not implemented if type is not first fieldgot %s, want variadic parameter with unnamed slice type or string as core type%s: FUNCDATA use of no_pointers_stackmap(SB) without FUNCDATA_LocalsPointerMapscannot convert slice with length %y to array or pointer to array with length %x%s not supported as argument to built-in %s for go1.18 (see go.dev/issue/50937)hot-big check disallows inlining for call %s (cost %d) at %v in big function %s
crypto/rand: blocked for 60 seconds waiting to read random data from the kernel
optimizer logging destination looked like file:// URI but failed to parse: err=%v (bad use of unsafe.Pointer or having race conditions? try -d=checkptr or -race)
cannot use type %s outside a type constraint: interface is (or embeds) comparablecannot use type %s outside a type constraint: interface contains type constraintscrypto/aes: internal error: using generic implementation despite hardware supportGCAdjust: AtExit goal %d gogc %d count %d maxprocs %d gcConcurrency %d overPct %d
-%s option should be '<version>,<destination>' where <version> is a number: err=%vMemory that is occupied by runtime mspan structures that are currently being used.expected all size classes up to min size for malloc header to fit in one-page spansMemory that is occupied by runtime mcache structures that are currently being used.json: invalid use of ,string struct tag, trying to unmarshal unquoted value into %vreflect: embedded type with methods not implemented if there is more than one fieldtypebits.Set: invalid initial alignment: type %v has alignment %d, but offset is %vcannot use ~ outside of interface or type constraint (use ^ for bitwise complement)%s: %d bytes of stack space saved via stack slot merging (%d nonpointer %d pointer)
invalid GOARM: must start with 5, 6, or 7, and may optionally end in either %q or %qstack too short to match cached location; stk = %#x, l.pcs = %#x, original stk = %#xinvalid argument: arguments to copy %s and %s have different element types %s and %sinvalid argument: cannot clear %s: argument must be (or constrained by) map or slicereflect.Value.Interface: cannot return value obtained from unexported field or methodcannot decode %q, export data version %d is greater than maximum supported version %dTimeBegin: %s
TimeEnd: %s
Program: %s
Version: %s
GoVersion: %s
GOOS: %s
GOARCH: %s

Assigning a bogus line to XPos with no file will cause mysterious downstream failures.reflect: New of type that may not be allocated in heap (possibly undefined cgo C type)Memory that is reserved for heap objects but is not currently used to hold heap objects.ActualExprConstantActualExprIsConcreteConvIfaceActualExprIsFuncActualExprIsInlinableFuncinternal error: DwarfFixupTable has orphaned fixup on %v targeting %v relidx=%d dclidx=%d%v: TLS MRC instruction must write to R0 as it might get translated into a BL instruction%s:   warning: truncated explanation due to assignment cycle; see golang.org/issue/35518
func must be func(yield func(...) bool): yield func returns user-defined boolean, not boolprofile does not contain a sample index with value/type "samples/count" or cpu/nanoseconds"cannot use interface %s in conversion (contains specific type constraints or is comparable)invalid GOARM64: must start with v8.{0-9} or v9.{0-5} and may optionally end in %q and/or %qalignment value of an instruction must be a power of two and in the range [8, 2048], got %d
alignment value of an instruction must be a power of two and in the range [4, 2048], got %d
invalid recursive type: anonymous interface refers to itself (see https://go.dev/issue/56103)%s:%s: when dynamic linking, R15 is clobbered by a global variable access and is used here: %voptimizer logging destination '<version>,<directory>' but could not create <directory>: err=%vUnexpected placement of op '%s' appearing after non-pseudo-op at beginning of block %s in %s
%soptimizer logging destination %s was neither %s-prefixed directory nor file://-prefixed file URInode [style=filled,fillcolor=white,fontsize=16,fontname="Menlo,Times,serif",margin="0.01,0.03"];bad offset of overflow in bmap for %v, overflow.Offset=%d, bucket.Size()-int64(types.PtrSize)=%dUNKNOEQNOALGMEMMEM0MEM8MEM16MEM32MEM64MEM128STRINGINTERNILINTERFLOAT32FLOAT64CPLX64CPLX128SPECIALDid not find a flag matching %s in -d=ssa/%s debug option (expected ssa/intrinsics/{on,off,debug})Did not find a flag matching %s in -d=ssa/%s debug option (expected ssa/genssa/dump=function_name)GCAdjust: Reset GOGC adjust, old goal %d, count is %d, gogc was %d, calcLive %d inUse %d overPct %d
cgocheck > 1 mode is no longer supported at runtime. Use GOEXPERIMENT=cgocheck2 at build time instead.GCAdjust: Retry GOGC adjust, current goal %d, count is %d, gogc was %d, is now %d, calcLive %d pctOff %d
Did not find a flag matching %s in -d=ssa/%s debug option (expected ssa/all/{time,mem,dump=function_name})Memory occupied by live objects and dead objects that have not yet been marked free by the garbage collector.internal error: DwarfFixupTable.ReferenceChildDIE unable to locate child DIE offset for dclIdx=%d src=%v tgt=%vGCAdjust: Retry GOGC adjust, current goal %d, count is %d, gogc was %d, is now %d, calcLive %d pctOff %d inUse %d
Did not find a flag matching %s in -d=ssa/%s debug option (expected ssa/build/{debug,test,stats,dump=function_name})PhaseOptions usage:

    go tool compile -d=ssa/<phase>/<flag>[=<value>|<function_name>]

where:

- <phase> is one of:
Memory used by execution trace buffers, structures for debugging the runtime, finalizer and profiler specials, and more.                                                                                                                                --------------------------------------------------------------------------------------------------------------------------------================================================================================================================================profile missing Function.start_line data (Go version of profiled application too old? Go 1.20+ automatically adds this to profiles)The current runtime.GOMAXPROCS setting, or the number of operating system threads that can execute user-level Go code simultaneously.<div class="zoom"><button onclick="return graphReduce('%s');">-</button> <button onclick="return graphEnlarge('%s');">+</button></div>ResultNoInfoResultIsAllocatedMemResultIsConcreteTypeConvertedToInterfaceResultAlwaysSameConstantResultAlwaysSameFuncResultAlwaysSameInlinableFuncDistribution of the time goroutines have spent in the scheduler in a runnable state before actually running. Bucket counts increase monotonically.TYPE_NONETYPE_BRANCHTYPE_TEXTSIZETYPE_MEMTYPE_CONSTTYPE_FCONSTTYPE_SCONSTTYPE_REGTYPE_ADDRTYPE_SHIFTTYPE_REGREGTYPE_REGREG2TYPE_INDIRTYPE_REGLISTTYPE_SPECIALParamNoInfoParamFeedsInterfaceMethodCallParamMayFeedInterfaceMethodCallParamFeedsIndirectCallParamMayFeedIndirectCallParamFeedsIfOrSwitchParamMayFeedIfOrSwitchHeap size target percentage configured by the user, otherwise 100. This value is set by the GOGC environment variable, and the runtime/debug.SetGCPercent function.EOFnameliteralopop=opop=:=<-*([{)]},;:....breakcasechanconstcontinuedefaultdeferelsefallthroughforfuncgogotoifimportinterfacemappackagerangereturnselectstructswitchtypevarCumulative count of heap allocations triggered by the application. Note that this does not include tiny objects as defined by /gc/heap/tiny/allocs:objects, only tiny blocks.Go runtime memory limit configured by the user, otherwise math.MaxInt64. This value is set by the GOMEMLIMIT environment variable, and the runtime/debug.SetMemoryLimit function.Cumulative count of heap allocations whose storage was freed by the garbage collector. Note that this does not include tiny objects as defined by /gc/heap/tiny/allocs:objects, only tiny blocks.Memory that is completely free and eligible to be returned to the underlying system, but has not been. This metric is the runtime's estimate of free address space that is backed by physical memory.Distribution of heap allocations by approximate size. Bucket counts increase monotonically. Note that this does not include tiny objects as defined by /gc/heap/tiny/allocs:objects, only tiny blocks.00010203040506070809101112131415161718192021222324252627282930313233343536373839404142434445464748495051525354555657585960616263646566676869707172737475767778798081828384858687888990919293949596979899xxxINT8UINT8INT16UINT16INT32UINT32INT64UINT64INTUINTUINTPTRCOMPLEX64COMPLEX128FLOAT32FLOAT64BOOLPTRFUNCSLICEARRAYSTRUCTCHANMAPINTERFORWANYSTRINGUNSAFEPTRIDEALNILBLANKFUNCARGSCHANARGSSSATUPLERESULTSNTYPEDistribution of freed heap allocations by approximate size. Bucket counts increase monotonically. Note that this does not include tiny objects as defined by /gc/heap/tiny/allocs:objects, only tiny blocks.All memory mapped by the Go runtime into the current process as read-write. Note that this does not include memory mapped by code called via cgo or via the syscall package. Sum of all metrics in /memory/classes.Memory that is completely free and has been returned to the underlying system. This metric is the runtime's estimate of free address space that is still mapped into the process, but is not backed by physical memory.Estimated total CPU time spent performing GC tasks. This metric is an overestimate, and not directly comparable to system CPU time measurements. Compare only with other /cpu/classes metrics. Sum of all metrics in /cpu/classes/gc.Estimated total CPU time spent performing background tasks to return unused memory to the underlying platform. This metric is an overestimate, and not directly comparable to system CPU time measurements. Compare only with other /cpu/classes metrics.